Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0005 0.21 11.3 0.1 14 41 28 52 25 54 0.90

2 10 0.0097 4.1 7.2 0.8 14 41 56 80 52 83 0.80

3 10 0.0068 2.9 7.7 0.3 17 41 87 108 82 110 0.84

4 10 0.013 5.6 6.7 1.0 17 41 115 136 109 138 0.86

5 10 0.015 6.5 6.5 1.7 17 41 143 164 137 169 0.82

6 10 0.033 14 5.5 0.3 17 41 171 192 165 194 0.83

7 10 0.017 7.4 6.4 2.0 14 41 196 220 188 222 0.82

8 10 0.019 8.3 6.2 0.9 17 41 227 248 221 250 0.83

9 10 0.14 58 3.5 2.3 16 41 254 276 245 278 0.80

10 10 0.19 80 3.0 6.9 14 43 280 310 272 311 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0005	0.21	11.3	0.1	14	41	28	52	25	54	0.90
2	10	0.0097	4.1	7.2	0.8	14	41	56	80	52	83	0.80
3	10	0.0068	2.9	7.7	0.3	17	41	87	108	82	110	0.84
4	10	0.013	5.6	6.7	1.0	17	41	115	136	109	138	0.86
5	10	0.015	6.5	6.5	1.7	17	41	143	164	137	169	0.82
6	10	0.033	14	5.5	0.3	17	41	171	192	165	194	0.83
7	10	0.017	7.4	6.4	2.0	14	41	196	220	188	222	0.82
8	10	0.019	8.3	6.2	0.9	17	41	227	248	221	250	0.83
9	10	0.14	58	3.5	2.3	16	41	254	276	245	278	0.80
10	10	0.19	80	3.0	6.9	14	43	280	310	272	311	0.73

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACGGCTGGATCGTCAGCGTCCGTGCGTGCTCCACGCGGTGTCTGCAATGGAGAGAAGCGTCTGGAGTGTCCAGTGTGCGAGAAGCAGTTCGCCTCAAGAAGTAACCTAGAAGCGCACCTTCGGACCCACACCGAGGAGAAGCccttcgagtgcacagtttgcaggAAGAGCTTCACTGAAAGTGGAAGTCTCAGTAGGCATCTTCggacccacaccggggagaagcctttcgagtgcgcaGTTTGCAGGCAGAAGTTCAGTCGAAGTGGTAGTCTCAGAGCACACCTTCGCAcacacaccggggagaagccttttgagtgcacagtttgcggGCAGAAGTTCAATCATAGTGGAGGTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCACTCAAAGTGGAAGTCTCAGAACGCAccttcgcacccacaccggggagaagccatttgagtgcacagtttgccgGAAGAAGTTCGCTCAAAGTGGAGATCTCAGAGCACAccttcgcacccacaccggggagaagccttttgagtgcacagtttgcggGCAGAAGTTCAATCATAGTGGAGGTCTCAGAACGCATCTTCggacccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCAATGAAAGTGGAGATCTTAGAAAGCACCTTCGCAcgcacaccggggagaagcctttcgagtgcacagtttgcaagaaCAAGTTCAATGAAAGTGGAGATCTTAGAAAGCACCTTCGCAcgcacaccggggagaagcctttcgagtgtaCAGTTTGCAAGAAGAAGTTTGTTCGTAGTGGACATCTTCGAACGCACCTCCTGACGCACACCCGGGACACGCATCGTGAGTGA
Protein Sequence: MSREREPRHRTAGSSASVRAPRGVCNGEKRLECPVCEKQFASRSNLEAHLRTHTEEKPFECTVCRKSFTESGSLSRHLRTHTGEKPFECAVCRQKFSRSGSLRAHLRTHTGEKPFECTVCGQKFNHSGGLRTHLRTHTGEKPFECTVCKKKFTQSGSLRTHLRTHTGEKPFECTVCRKKFAQSGDLRAHLRTHTGEKPFECTVCGQKFNHSGGLRTHLRTHTGEKPFECTVCKKKFNESGDLRKHLRTHTGEKPFECTVCKNKFNESGDLRKHLRTHTGEKPFECTVCKKKFVRSGHLRTHLLTHTRDTHRE

Sequence clustering based on sequence similarity using MMseqs2