Basic Information

Insect: Thereva nobilitata
Gene Symbol: -
Assembly: GCA_963855945.1
Location: OY979698.1:12476783-12478682[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00011 0.028 16.6 2.9 2 23 147 168 146 168 0.97

2 6 3.4e-08 8.3e-06 27.7 0.9 1 23 174 196 174 196 0.98

3 6 6.1e-06 0.0015 20.6 0.4 1 23 202 224 202 224 0.98

4 6 4.1e-07 9.9e-05 24.3 0.1 2 23 231 252 230 252 0.97

5 6 8.4e-05 0.02 17.0 3.5 1 23 258 281 258 281 0.96

6 6 7.5e-08 1.8e-05 26.6 2.3 1 23 290 312 290 312 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00011	0.028	16.6	2.9	2	23	147	168	146	168	0.97
2	6	3.4e-08	8.3e-06	27.7	0.9	1	23	174	196	174	196	0.98
3	6	6.1e-06	0.0015	20.6	0.4	1	23	202	224	202	224	0.98
4	6	4.1e-07	9.9e-05	24.3	0.1	2	23	231	252	230	252	0.97
5	6	8.4e-05	0.02	17.0	3.5	1	23	258	281	258	281	0.96
6	6	7.5e-08	1.8e-05	26.6	2.3	1	23	290	312	290	312	0.99

Sequence Information

Coding Sequence: ATGGATTACAATATTCATAAAATATGCCGGATATGTTTAGAAGAAGGTGCTCTTACTTCGATTTACAGTATTGATTTTGCAATGATGCCATCTACAATGATTATGATGTGCGCTAAAGTtcgaGTATTTAAATCTGACGGCTTACCGTCTGTAATATGCAATAATTGTATCTACCGACTGGGAGTTGCATATCATTTTAAACAGGAATGTGAAAATTCGGATATGAGGGTGCGACAGTACTTAGGGATGGCCGATAGGGGATATGGGTTCTGCGATGCTGAAACGATGACCGATTCTTCGTTGTTAGAAGAACCAAAAAAGGAAGATgatgaaaagaaaattaaactgaaaaagAGTAAGCGAAGAAGTAGATACAAGCGTAAAGCCCCAGAAGAACGTAAGAAACGTGGTCCCAAGCCAGCTCCTAAAGTTCCACAAACATGTTACGAATGCAACAAAACATttaagtgcgctgcacagctcCAAATGCACATAAGAACACATACCGGAGAACGCCCATTTGTTTGCACATATTGTCCGCGACGATTTGCCCAAAAATACAATCTTCTGATTCACATAAGAACTCATACTGGAGAACGACCATTTCAATGTGAAATATGCAGCAAACAATTTTCAGCTCTAGGAAATTTTCAAGCACATCAAAAAATACATACTGGCGTTCGAGATCAAGTTTGCCCTGTTTGTAATAAGGCATTTTACAGTTCTGGCGACCTATCTAAACACATGATAACACATACCGGCATTAAAAATCATCATTGCGACACTTGCGGGAAGGCGTTCAGTAGAAATCGAGATATGGTAGCACATAAGAAGAAAATCCatttaaatgaaagaaattCCGAGAATTTTAAATGTCCTGAATGTCATAAAGTCTTTGCAACTTCTAGTAGCTTAAGTGTACACTTTCGCACACATGGTGGTGTACCTTTAGTACAACCCACAATTCAACCTCCTGTGCCAGCACCTATAGCTCCAACAGCAATCGGAGGGAGCTTAGGTGCACCGCCTATAGGCTCAACACTTGGAGTTGGTATTGGCCTACCGCCACCTGGAAGTTTAGGAATGTTATCTCACACCCAAGGAACATTGAGTATGATGCATACGCAAAGGCTTCATCCTTATTAA
Protein Sequence: MDYNIHKICRICLEEGALTSIYSIDFAMMPSTMIMMCAKVRVFKSDGLPSVICNNCIYRLGVAYHFKQECENSDMRVRQYLGMADRGYGFCDAETMTDSSLLEEPKKEDDEKKIKLKKSKRRSRYKRKAPEERKKRGPKPAPKVPQTCYECNKTFKCAAQLQMHIRTHTGERPFVCTYCPRRFAQKYNLLIHIRTHTGERPFQCEICSKQFSALGNFQAHQKIHTGVRDQVCPVCNKAFYSSGDLSKHMITHTGIKNHHCDTCGKAFSRNRDMVAHKKKIHLNERNSENFKCPECHKVFATSSSLSVHFRTHGGVPLVQPTIQPPVPAPIAPTAIGGSLGAPPIGSTLGVGIGLPPPGSLGMLSHTQGTLSMMHTQRLHPY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00203836;
90% Identity: iTF_01256590;
80% Identity: -