Basic Information

Insect: Theocolax elegans
Gene Symbol: -
Assembly: GCA_026168455.1
Location: CM047428.1:60341788-60343977[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 15 0.17 63 6.3 0.7 2 23 101 122 100 122 0.97

2 15 0.00014 0.051 16.0 2.2 2 23 127 148 127 148 0.98

3 15 5.3e-06 0.002 20.4 2.5 2 23 155 176 154 176 0.97

4 15 3.1e-07 0.00012 24.3 0.5 1 23 210 232 210 232 0.98

5 15 0.00027 0.099 15.1 0.2 1 20 238 257 238 260 0.94

6 15 1.3e-06 0.00049 22.3 2.5 1 23 266 288 266 288 0.97

7 15 7.2e-07 0.00027 23.2 1.8 1 23 294 316 294 316 0.96

8 15 4.4e-05 0.016 17.5 0.4 1 23 322 344 322 344 0.98

9 15 1.6e-05 0.0058 19.0 7.2 1 23 350 372 350 372 0.97

10 15 1.6e-08 6.1e-06 28.3 0.6 1 23 377 399 377 399 0.97

11 15 7.4e-05 0.027 16.8 0.3 1 23 405 427 405 427 0.97

12 15 5.1e-06 0.0019 20.5 7.0 1 23 433 455 433 455 0.97

13 15 7.8e-07 0.00029 23.0 1.1 1 23 461 483 461 483 0.99

14 15 4.1e-06 0.0015 20.8 0.7 1 23 489 511 489 511 0.97

15 15 9.8e-05 0.037 16.4 1.5 2 23 518 540 518 540 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	15	0.17	63	6.3	0.7	2	23	101	122	100	122	0.97
2	15	0.00014	0.051	16.0	2.2	2	23	127	148	127	148	0.98
3	15	5.3e-06	0.002	20.4	2.5	2	23	155	176	154	176	0.97
4	15	3.1e-07	0.00012	24.3	0.5	1	23	210	232	210	232	0.98
5	15	0.00027	0.099	15.1	0.2	1	20	238	257	238	260	0.94
6	15	1.3e-06	0.00049	22.3	2.5	1	23	266	288	266	288	0.97
7	15	7.2e-07	0.00027	23.2	1.8	1	23	294	316	294	316	0.96
8	15	4.4e-05	0.016	17.5	0.4	1	23	322	344	322	344	0.98
9	15	1.6e-05	0.0058	19.0	7.2	1	23	350	372	350	372	0.97
10	15	1.6e-08	6.1e-06	28.3	0.6	1	23	377	399	377	399	0.97
11	15	7.4e-05	0.027	16.8	0.3	1	23	405	427	405	427	0.97
12	15	5.1e-06	0.0019	20.5	7.0	1	23	433	455	433	455	0.97
13	15	7.8e-07	0.00029	23.0	1.1	1	23	461	483	461	483	0.99
14	15	4.1e-06	0.0015	20.8	0.7	1	23	489	511	489	511	0.97
15	15	9.8e-05	0.037	16.4	1.5	2	23	518	540	518	540	0.95

Sequence Information

Coding Sequence: ATGCCATGCCGAAGTCGGGTTATGGTGCTCTGCTTTTTGCAAGACCCTGGTGTAATATACAAATTCAACTACATGGAGGACATTTGTTTGGGTACTTTTGATAAGGTCTTCCAACCAATTGACCATCATGAGGTGGAATTTCCTGATGAAATGGTAAAATTGGAGCTAGATGGGGACGGTAGCCATCATCATTGGGCAGCTCAATTAGCGAATGCAACATTATCCGACAATGGAGAATACAGTTCGCAAGGTGATAATCACTTTCTCAACTCGAGTGCGGCACAAAAGTTTTATAAAATTCAGTGCACTTTGTGCAAAAAGTGGTTCTTAAACAATGATTCCATGGTGACACATTTGAAGATGCATTGTAGTGGTAACACTTGTGAAGTTTGCCATCAAAATTTCATGGATAATGCAAGTTTGCATGCTCATATGTTGACTCACGTTGGTATGAGCCCAGTTGAATGTACAATATGTCAAAAAAGATTTGCATACAAATGGTGTTTACGTAATCACATGCAAACTCATATGCCAAATAAGCAGTTGGAATATGATAGTTTACAACAAGCATTTTTAAAGCGTTATGGTCATACCAATGATCACGCaatacgtgatgaagaaaggccttatgtttgtcaagtttgtcaaacttcgtttagggaaaaaggtaatttgaaccgacacatgttaatacataccggagagaaaccctacaagtgtgaaatatgttttgcttcatttcgtgagaaagctaaactaaatatccatatgcctgtacacactggacataaacagttcaaatgcaccatgtgtcatcggtcgtttgttcaaaaaactgcattgaacaatcatatgttagcgcatagtggagagaagccacacgcgtgcaacatttgtgaaaaaacatataaaaggaagtccgaattaattagacatacaatgattcacactggagaacgaccctatgaatgtcaagagtgtttgatgactttcagagagaaagcaaaattaaattctcacatgttagttcacacaggtgaaaaaccacatgaatgtcacatatgccacaaggcgtgtgctcgaaaatcagatttaaatagtcatatgctctctcatactgggggtcaatatgactgcaaagtatgtgataaaatttttacgcgaaagtcagatttaaatagacacattttggttcacactggagagaaaccttacgcttgtgaatattgcgatatggcattcagagaaaaaacaagactgaattcacatatggttattcacacaggagataaaaggcatatatgtcacatttgtcataagggcttccgagaaaaatcaatgctaaaaaaacacatgttaactcatactggtgatagaccatacgaatgttatgtatgccaaaaagcatttacacagaaaacaactctgaacagccacattcttacgcatacatcagaaacatcctacgaatgtactatatgtagaaaagtttatagagaaaaatcagcactaagaaaacatcttgtgtcgcatacagcagataagaataatgaatgtcctatttgtttaaagaaattctctcataaaacAGCTCTAAGCAGTCATATAACATCGTCTCACTCTTTGTAA
Protein Sequence: MPCRSRVMVLCFLQDPGVIYKFNYMEDICLGTFDKVFQPIDHHEVEFPDEMVKLELDGDGSHHHWAAQLANATLSDNGEYSSQGDNHFLNSSAAQKFYKIQCTLCKKWFLNNDSMVTHLKMHCSGNTCEVCHQNFMDNASLHAHMLTHVGMSPVECTICQKRFAYKWCLRNHMQTHMPNKQLEYDSLQQAFLKRYGHTNDHAIRDEERPYVCQVCQTSFREKGNLNRHMLIHTGEKPYKCEICFASFREKAKLNIHMPVHTGHKQFKCTMCHRSFVQKTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMIHTGERPYECQECLMTFREKAKLNSHMLVHTGEKPHECHICHKACARKSDLNSHMLSHTGGQYDCKVCDKIFTRKSDLNRHILVHTGEKPYACEYCDMAFREKTRLNSHMVIHTGDKRHICHICHKGFREKSMLKKHMLTHTGDRPYECYVCQKAFTQKTTLNSHILTHTSETSYECTICRKVYREKSALRKHLVSHTADKNNECPICLKKFSHKTALSSHITSSHSL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01469925;
90% Identity: iTF_01110359;
80% Identity: -