Tpit024123.1
Basic Information
- Insect
- Thaumetopoea pityocampa
- Gene Symbol
- fap1
- Assembly
- GCA_017165845.1
- Location
- WUAW01035508.1:1-4769[+]
Transcription Factor Domain
- TF Family
- zf-NF-X1
- Domain
- zf-NF-X1 domain
- PFAM
- PF01422
- TF Group
- Zinc-Coordinating Group
- Description
- This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.88 1.3e+04 -3.0 0.5 6 10 22 26 21 26 0.82 2 6 2.6e-09 3.9e-05 24.3 11.8 1 19 32 50 32 50 0.97 3 6 0.21 3e+03 -1.0 0.6 11 16 81 86 80 87 0.67 4 6 0.00016 2.3 9.0 14.9 1 18 91 108 91 109 0.97 5 6 1.8 2.7e+04 -4.0 1.2 1 3 140 142 140 144 0.53 6 6 0.0026 38 5.1 3.6 1 13 150 166 149 167 0.84
Sequence Information
- Coding Sequence
- NNGCGCTGCGGCTGCGGCGCGGAGACCCGATCAGTGTTGTGCAGCAGCAAGTTGCCGCAAGTGTGCAGCCGCGCATGTAACCGCACACTGGAGTGTGGCGTGCACAAGTGCGCTAAGAGTTGCCACGAAGGCAATTGCGATAATTGCACTGAAATTGTCACTCAGGTGTGCTTCTGCCCGGCGGCGAAGTGTCGGTCGGTGCTGTGCACGGCGGAGACGGGACAGAGCGCGCAGTGGACGTGCGAGGGCGAGTGCGGCCGCGTGCTGGCGTGCGGCGCGCACGTGTGCCGCGCGCGCTGCCACGCGCCGCCCTGCGAGCCCTGCCACCTGCTGCCGCACCTAGTGCTCACTTGCCCCTGCGGGAAGACACGATTAAACAAAGACTCGCGTAAATCGTGCACCGATGCGATCCCCTTGTGCGGCAACATCTGCGCAAAGCCTCTGCCTTGCGGCCCCGCCGGAGACAGGCACTTCTGCAAGATCAACTGCCATGaaggtaaatattttatatcctaCTAA
- Protein Sequence
- XRCGCGAETRSVLCSSKLPQVCSRACNRTLECGVHKCAKSCHEGNCDNCTEIVTQVCFCPAAKCRSVLCTAETGQSAQWTCEGECGRVLACGAHVCRARCHAPPCEPCHLLPHLVLTCPCGKTRLNKDSRKSCTDAIPLCGNICAKPLPCGPAGDRHFCKINCHEGKYFISY*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -