Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00013 0.21 12.2 0.4 13 38 78 100 73 105 0.86

2 5 0.002 3.3 8.4 0.9 17 28 113 124 103 139 0.77

3 5 0.058 96 3.7 0.3 18 28 140 150 130 162 0.80

4 5 0.00013 0.21 12.2 0.5 19 41 169 188 156 190 0.88

5 5 0.036 60 4.3 3.8 14 43 192 218 188 219 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00013	0.21	12.2	0.4	13	38	78	100	73	105	0.86
2	5	0.002	3.3	8.4	0.9	17	28	113	124	103	139	0.77
3	5	0.058	96	3.7	0.3	18	28	140	150	130	162	0.80
4	5	0.00013	0.21	12.2	0.5	19	41	169	188	156	190	0.88
5	5	0.036	60	4.3	3.8	14	43	192	218	188	219	0.89

Coding Sequence: TCGCAGACCAATCAGCTACGCCAACAAGAACAAACGCCGCCGCAGCCGCAGTCGCCCGCAACCGCGGAAGCCACCGGCGGAAACTGCAACGTCGGCAGGGATAGCACCACCGCCGGCAGCAAAACTGTCGCCTACACCTACGAGGCCTTCTTCGTGTCCGACGGCCGATCAAAACGACGCGGCGGGAGCAGCAACAATGCTGCCGTGCCCGAGAAAGAGGCGGCCCAGCCGGACAGGCCCAAGTTCACATGTACCGAGTGCGGCAAGCAGTACGCGACCTCGTCGAATCTGTCGCGGCACAAGCAGACGCACCGCAGCCTCGACTCGCAATCGGCCAAGAAGTGCATCCACTGCGGCAAGGCGTACGTCAGCATGCCCGCCCTGGCGATGCACGTGCTCACGCACAAGCTCGCCCACAGCTGCGGCGTCTGCGGCAAGATGTTCTCGCGGCCCTGGCTGCTGCAGGGCCACTTGCGCAGCCACACCGGCGAGAAGCCGTACGGGTGCGCTCACTGCGGCAAGGCGTTCGCCGATCGCTCGAATCTGCGGGCGCACATGCAGACGCACTCGGCCGACAAGAACTACGAGTGCTCGAGGTGCCACAAGACCTTCGCCCTCAAGTCCTATCTGAACAAACACCTGGAGTCGGCGTGCCTGCGCGACGAGGAgatgcagcagcagcagcaacagcagcagcagccgcagcagcagcatgCCACTAATAACGCCACGCAGCAACAGAACACCAATCGAGGCTTGTAG
Protein Sequence: SQTNQLRQQEQTPPQPQSPATAEATGGNCNVGRDSTTAGSKTVAYTYEAFFVSDGRSKRRGGSSNNAAVPEKEAAQPDRPKFTCTECGKQYATSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKMFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECSRCHKTFALKSYLNKHLESACLRDEEMQQQQQQQQQPQQQHATNNATQQQNTNRGL

Sequence clustering based on sequence similarity using MMseqs2