Tsim018794.1
Basic Information
- Insect
- Tetramorium simillimum
- Gene Symbol
- Cebpg
- Assembly
- GCA_011636635.1
- Location
- VBVQ01003401.1:3603-4507[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 7.9 1.1e+04 -3.0 0.2 21 26 10 15 6 18 0.58 2 3 1.2e-15 1.7e-12 47.7 5.4 3 65 22 84 20 84 0.96 3 3 3.1 4.3e+03 -1.7 0.3 39 50 108 119 102 120 0.53
Sequence Information
- Coding Sequence
- ATGGCgccgaaaaataaagaaaatagcaAACGAAAGAAGCAGACAATAGAAGACGAGGGCGACGAAGATTATCGAAAGCGGCGGGATCGGAATAACCAGGCCGTGAAACGATCCAGAGTGAAGAGTAAATTGCGCACGCAACAAACTTTGGAACGAGTCAACCAGCTGAAAACGGAGAACGAATTGTTGgaggagaaaattaaaatgcttaCCAAGGAACTTGGATTTCTCAAAGATCTCTTCATTGCACATGCAGgaGGATCCAGTCAACACACCATAAACATTCAAGATCTAGATCTAAATGCTCTCCTGGCAGAAGAAAAACCGACGGAAGAGTTGCTAAAGACTAATACCAAGCTGTAG
- Protein Sequence
- MAPKNKENSKRKKQTIEDEGDEDYRKRRDRNNQAVKRSRVKSKLRTQQTLERVNQLKTENELLEEKIKMLTKELGFLKDLFIAHAGGSSQHTINIQDLDLNALLAEEKPTEELLKTNTKL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01269550;
- 90% Identity
- iTF_00884800;
- 80% Identity
- -