Basic Information

Insect: Tenthredo distinguenda
Gene Symbol: -
Assembly: GCA_947538915.1
Location: OX384530.1:18299201-18300446[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.013 1.8 9.9 0.3 3 23 47 68 46 68 0.97

2 10 0.00012 0.016 16.4 1.2 1 23 74 97 74 97 0.98

3 10 0.0015 0.21 12.9 2.0 2 23 103 125 102 125 0.96

4 10 0.0079 1.1 10.6 2.2 1 23 131 153 131 153 0.97

5 10 3.9e-05 0.0054 17.9 1.3 2 23 160 182 159 182 0.96

6 10 0.00049 0.067 14.5 6.0 1 23 198 221 198 221 0.91

7 10 0.0032 0.45 11.9 0.2 1 23 233 255 233 255 0.95

8 10 0.004 0.55 11.6 3.6 1 23 261 283 261 283 0.94

9 10 1e-07 1.4e-05 26.1 1.8 1 23 289 311 289 311 0.98

10 10 7.7e-05 0.011 17.0 0.2 1 21 317 337 317 338 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.013	1.8	9.9	0.3	3	23	47	68	46	68	0.97
2	10	0.00012	0.016	16.4	1.2	1	23	74	97	74	97	0.98
3	10	0.0015	0.21	12.9	2.0	2	23	103	125	102	125	0.96
4	10	0.0079	1.1	10.6	2.2	1	23	131	153	131	153	0.97
5	10	3.9e-05	0.0054	17.9	1.3	2	23	160	182	159	182	0.96
6	10	0.00049	0.067	14.5	6.0	1	23	198	221	198	221	0.91
7	10	0.0032	0.45	11.9	0.2	1	23	233	255	233	255	0.95
8	10	0.004	0.55	11.6	3.6	1	23	261	283	261	283	0.94
9	10	1e-07	1.4e-05	26.1	1.8	1	23	289	311	289	311	0.98
10	10	7.7e-05	0.011	17.0	0.2	1	21	317	337	317	338	0.95

Sequence Information

Coding Sequence: ATGATATTTAGTTACATCAAATTATGTTGCAGCCAGTGGTCTGTCGACCATGAACAGTTCGATGAAACAGAGCTTAAGGTCAAGATTGAGAACGACCCTATCCCTACAGAGGCAAAGTCAGAGGGCAATATAAAGGCGTGTGAAATATGCAATGAAAAGTTTCACTTTGTAACGCGGCTGGTAGCACATCTGAGAATAGCTCACGGAATTCAGAGACCATTCAAGTGCAGTTCTTGCTGGAGAACTTACGCTCAACAATTCATGCTGAATGCACATGTGAAAAAGTCTCATACACCGAAGAACGTGTCCTGCGAGCAATGCAAGTTCATATGTGTCACAAATGCGGATCTAGAGAGGCATAGGAAGAAACAGCATGAGCCCAAGATGAAATTCTACTGTGAGCTTTGCTGCGAAACATTCACGGACAAGGAATCTTTCGCAACACATACGGCGATGCATAATTTCATTGAATATCAGCAGTGTAACACTTGCGGCATAACTTTCAACGACGTTGATTCACTGAAGGAGCATCACAGATTGTATCACTTCGATATGCCTGCGGCGGCGATAGAGCCGAGCGGAGAGTCAGATCATAAGTGTGATATTTGTGGGAAATGTTACAGATTCAAATCTGTTTTGAAACAGCACAAATTCAACGTTCACGGCACCCCGAATTATGAAAGGCCTAGGCGCAGGTATCTCtgtgccctctgcggaaaagaattgaaaacggctaagggctttgagattcacaaccgatctcataccggtgagaaaccctacacctgcgaagtgtgcgggaaatgttttgcatgtgaaactctgctcagaacgcataatgtcactcatacaggggagagaaaatacacttgcgaacaatgcggtaaatcctttacccaaagatccacccttgtcgttcacaagagatatcacaccggggaacgtccctacgtatgtccaaagtgtagcaagggttttgttaCTCGAACTGTACTCAATACGCATCTGAAATCCTGCCGCTGA
Protein Sequence: MIFSYIKLCCSQWSVDHEQFDETELKVKIENDPIPTEAKSEGNIKACEICNEKFHFVTRLVAHLRIAHGIQRPFKCSSCWRTYAQQFMLNAHVKKSHTPKNVSCEQCKFICVTNADLERHRKKQHEPKMKFYCELCCETFTDKESFATHTAMHNFIEYQQCNTCGITFNDVDSLKEHHRLYHFDMPAAAIEPSGESDHKCDICGKCYRFKSVLKQHKFNVHGTPNYERPRRRYLCALCGKELKTAKGFEIHNRSHTGEKPYTCEVCGKCFACETLLRTHNVTHTGERKYTCEQCGKSFTQRSTLVVHKRYHTGERPYVCPKCSKGFVTRTVLNTHLKSCR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00060588;
90% Identity: iTF_01411805; iTF_01414463; iTF_00939018; iTF_00939875;
80% Identity: -