Basic Information

Insect: Tenebrio molitor
Gene Symbol: -
Assembly: GCA_963966145.1
Location: OZ014538.1:43430726-43432825[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00022 0.018 16.0 1.3 3 21 4 22 2 23 0.93

2 9 4.3e-05 0.0037 18.2 6.0 1 21 46 66 46 67 0.95

3 9 6.4e-05 0.0054 17.7 2.5 1 23 75 98 75 98 0.95

4 9 4.3e-08 3.7e-06 27.7 3.9 1 23 107 129 107 129 0.99

5 9 9.4e-06 0.0008 20.3 2.1 3 21 171 189 167 190 0.92

6 9 0.0013 0.11 13.6 0.6 2 23 199 221 198 221 0.94

7 9 3.9e-05 0.0033 18.4 0.1 1 21 226 246 226 247 0.94

8 9 2.1e-05 0.0018 19.2 0.7 1 20 266 285 266 287 0.95

9 9 1.8 1.5e+02 3.7 0.1 2 23 296 320 295 320 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00022	0.018	16.0	1.3	3	21	4	22	2	23	0.93
2	9	4.3e-05	0.0037	18.2	6.0	1	21	46	66	46	67	0.95
3	9	6.4e-05	0.0054	17.7	2.5	1	23	75	98	75	98	0.95
4	9	4.3e-08	3.7e-06	27.7	3.9	1	23	107	129	107	129	0.99
5	9	9.4e-06	0.0008	20.3	2.1	3	21	171	189	167	190	0.92
6	9	0.0013	0.11	13.6	0.6	2	23	199	221	198	221	0.94
7	9	3.9e-05	0.0033	18.4	0.1	1	21	226	246	226	247	0.94
8	9	2.1e-05	0.0018	19.2	0.7	1	20	266	285	266	287	0.95
9	9	1.8	1.5e+02	3.7	0.1	2	23	296	320	295	320	0.94

Sequence Information

Coding Sequence: ATGATCGCGTGCAGGCGGTGTGGGAAACGGTACAAGtacaagaaaaattttcaGCGACACGTCAAGTACGAGTGCCAGAAACCGCCCCAGTTCGCCTGTTATTTCTGTCCTTCCAAGTTTACCCAAAACAggaAACACCAGTGCCACACGTGCGGGAAATCCTACAGGCACAAGCCCAATCTGTACAGGCACAGGAAGTACGAGTGCGCGGGGGTGGCGCATTTCAGGTGCTTCTACTGCTCCAAAGCGTTTTTCCAAAAAGTCACACTTAACAAACACCTTTCTAACGTCCACGCCTTCTTCGACAAGCGACATTGTTTTCAGTGCGAAAAGTGCGGAAAATCCTACAAGCACAAAGGCAATTTGAATCAACATTTGAGATCCCACTACGGCGGTGGAGACGTTGTAGTAGAGGAGCGCAAAGAGCAAATTCTTATAGAGTTTGTGTCGGGTGAGCCTGTAGAGAGCGAAGACTGTTCGGTCTCGGACAGTGAGATATTCACCTGTCTTTGCAACAACTGCGGCAAGATGTACAAATCGAAAGGCAACCTGCAGAGGCACTTGAACTACGAGTGCGGGAAGGAGCCCCACATCACCTGCCCCCTGTGCGGCCTCCAGACCAAGTACCGCTCCAGCATGAAGCGGCACGTCCTTAACCGCCACCCCGGGCAACTTTATGCGTGTCCGGGTTGCGATAAGGCGTACAAATCGATCAACTCGCTCAGGAGACATGTCAAGTACATGTGCGGCCGTAGAGAACCACCCCTTACAGGATACACTCACCtcgaaaacagttttatttgtaacAAGTGTGATAAAATATACAAGAGCAAGAGCTCGATGCGGCGCCACTTGGTCTACGAGTGCGGGAAGATGCCCAACATCGAGTGCCCCATAATGGGCTGCCCGTACAAGTCCAAGCTGAGGGACAGGATGTCCCAGCACGTCAAGATGGTCCACAAGTTGATGTTATAG
Protein Sequence: MIACRRCGKRYKYKKNFQRHVKYECQKPPQFACYFCPSKFTQNRKHQCHTCGKSYRHKPNLYRHRKYECAGVAHFRCFYCSKAFFQKVTLNKHLSNVHAFFDKRHCFQCEKCGKSYKHKGNLNQHLRSHYGGGDVVVEERKEQILIEFVSGEPVESEDCSVSDSEIFTCLCNNCGKMYKSKGNLQRHLNYECGKEPHITCPLCGLQTKYRSSMKRHVLNRHPGQLYACPGCDKAYKSINSLRRHVKYMCGRREPPLTGYTHLENSFICNKCDKIYKSKSSMRRHLVYECGKMPNIECPIMGCPYKSKLRDRMSQHVKMVHKLML

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -