Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.2 1.9e+02 4.1 5.1 1 23 14 37 14 37 0.80

2 7 2.3e-08 3.6e-06 28.4 2.8 1 23 44 66 44 66 0.99

3 7 3.2e-06 0.00049 21.7 0.5 1 23 72 94 72 94 0.96

4 7 1.1e-06 0.00017 23.1 5.8 1 23 100 122 100 122 0.99

5 7 3e-05 0.0046 18.6 4.6 1 21 128 148 128 150 0.95

6 7 9.3e-05 0.014 17.1 2.2 1 23 156 178 156 178 0.99

7 7 0.29 45 6.1 0.1 1 19 209 227 209 229 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.2	1.9e+02	4.1	5.1	1	23	14	37	14	37	0.80
2	7	2.3e-08	3.6e-06	28.4	2.8	1	23	44	66	44	66	0.99
3	7	3.2e-06	0.00049	21.7	0.5	1	23	72	94	72	94	0.96
4	7	1.1e-06	0.00017	23.1	5.8	1	23	100	122	100	122	0.99
5	7	3e-05	0.0046	18.6	4.6	1	21	128	148	128	150	0.95
6	7	9.3e-05	0.014	17.1	2.2	1	23	156	178	156	178	0.99
7	7	0.29	45	6.1	0.1	1	19	209	227	209	229	0.94

Coding Sequence: AtggaaaataaagaaacaaataatcAGTTACTTCCAAATTATAGTTGCAAGCGTTGCAAACGGTCCTTCAAATGCAAACGTGACCAGTTACTGCATAAAAAGGAGGTGCATACACTACATAATACGTCATATGAATGTCAGATATgtaataaattcttttgtaaTAATGGAAATTTAGAACGTCATATGAAGGTGCATAATGACGTTCGTCCACATGTGTGCGTTACATGCAATAAAGCATTCGCGCAAGCTGTAAACTTGCAGCGACATTATTCCGTGCACAGTGGCGAAAGACCCTATAAATGCAGTTTCTGTGCCAAATGCTTCACACAACAAAGCAATATGCAACGCCATCAGCTTACACATACAGGTGAAAAGCCTTTTCGTTGCAAACGTTGTGGTCGCTACTTCTCACAGCGCGTTAATCTCAGAAAGCATATCCTCTGTCATCTTAATGCAAAACCCTATAAATGCAAACTTtgtgacaaaaattttatgcaactgCAATCTGCTCGAAGACATTTAACCACTCACGTTAAGGAAGGTATTGTTGACGTTAGTGATGCCCTTGAAGTTACCAGCGTTTTGAATGAAGTGTTGATTCCACCCGATGAACCAGCTAACTTTGAATGTGCAGTATGTCGTAGCATATTCAGCACTTTTGCTGAGTTTGAATTACATGAAGAGGACTGTTTAGGCACGGATGATCAACCTTTTCAAGAAATAGTAGTAGAAAcggcaaaataa
Protein Sequence: MENKETNNQLLPNYSCKRCKRSFKCKRDQLLHKKEVHTLHNTSYECQICNKFFCNNGNLERHMKVHNDVRPHVCVTCNKAFAQAVNLQRHYSVHSGERPYKCSFCAKCFTQQSNMQRHQLTHTGEKPFRCKRCGRYFSQRVNLRKHILCHLNAKPYKCKLCDKNFMQLQSARRHLTTHVKEGIVDVSDALEVTSVLNEVLIPPDEPANFECAVCRSIFSTFAEFELHEEDCLGTDDQPFQEIVVETAK

Sequence clustering based on sequence similarity using MMseqs2