Svit024959.1
Basic Information
- Insect
- Syrphus vitripennis
- Gene Symbol
- Cebpg_1
- Assembly
- GCA_958431115.1
- Location
- OY288110.1:22099515-22100143[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.9e-09 3.6e-06 27.9 11.6 3 62 23 82 21 84 0.96
Sequence Information
- Coding Sequence
- ATGCCGGCCAAAAGAAGAACTGCAAAATCCGTAGCATCAAGTGGCAATTCCGATGACGGCAATGGTGATGAATATCGCCAGAAGAGGATGCGAAATAATGAggcAGTCAAGAAGTCACGAGagaaaaccaacaaaacagCCACAGAGAGAAAACAGCGCGTGGAAGCATTAAAAACAGAGAACATTCGCCTTGAGACACAAATcaaagaaactgaaaaaaatatcgaaacacTCAAAAGTTTGCTTCTATCAAATGCTAAAAGCACTGTGGAAAAGGACAAACTGGTCAAGGAGATCCTTGCGGAAACTAGTGATAGCGAATGA
- Protein Sequence
- MPAKRRTAKSVASSGNSDDGNGDEYRQKRMRNNEAVKKSREKTNKTATERKQRVEALKTENIRLETQIKETEKNIETLKSLLLSNAKSTVEKDKLVKEILAETSDSE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00309976;
- 90% Identity
- iTF_00664611;
- 80% Identity
- -