Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.11 53 4.2 3.8 17 29 26 38 17 52 0.76

2 11 0.65 3.3e+02 1.7 2.0 16 35 53 73 43 80 0.76

3 11 0.13 65 3.9 2.6 18 38 83 100 74 106 0.74

4 11 0.014 7.1 7.0 0.2 18 43 111 133 108 134 0.89

5 11 0.00032 0.16 12.3 0.3 18 43 139 161 136 162 0.88

6 11 0.0084 4.2 7.7 1.1 18 33 167 179 165 190 0.74

7 11 0.0037 1.9 8.9 0.6 18 43 195 217 193 218 0.88

8 11 0.00019 0.098 13.0 0.4 15 43 223 248 220 249 0.88

9 11 0.0037 1.9 8.8 0.2 18 43 254 276 252 277 0.87

10 11 0.025 13 6.2 1.4 18 43 282 304 279 305 0.82

11 11 0.00028 0.14 12.4 1.2 17 43 309 332 307 333 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.11	53	4.2	3.8	17	29	26	38	17	52	0.76
2	11	0.65	3.3e+02	1.7	2.0	16	35	53	73	43	80	0.76
3	11	0.13	65	3.9	2.6	18	38	83	100	74	106	0.74
4	11	0.014	7.1	7.0	0.2	18	43	111	133	108	134	0.89
5	11	0.00032	0.16	12.3	0.3	18	43	139	161	136	162	0.88
6	11	0.0084	4.2	7.7	1.1	18	33	167	179	165	190	0.74
7	11	0.0037	1.9	8.9	0.6	18	43	195	217	193	218	0.88
8	11	0.00019	0.098	13.0	0.4	15	43	223	248	220	249	0.88
9	11	0.0037	1.9	8.8	0.2	18	43	254	276	252	277	0.87
10	11	0.025	13	6.2	1.4	18	43	282	304	279	305	0.82
11	11	0.00028	0.14	12.4	1.2	17	43	309	332	307	333	0.93

Coding Sequence: ATGACTACGAAAGAGCAATTGGTTGTACACGAAAGGATACACACGGGTGTAAAATCGTATGTGTGCCAAAAGCCTTACGTTTGTAACGTGTGTAATAAAAGGTTCACGCGCAAACAATGTAAGGAAAGACACATGTTGACGCATACAGGGATAAAATCTTTCCAATGCAGTGTCTGTAGCAAGACATTTGGGCAAAAACATCAGCTCACTAGTCACATGGCGGTCCATAATCGCGAAAGACCCTACAACTGCGACATTTGCAAAAAGACATTTAAATACAAGTATCATATGCGTCTGCACATATCGTCTGTACATTTGGGCATTATATTTGAGTGCGACATTTGTAAGACGACATTTAAATACAAGGAAAATATACGCCAGCACATGTCTGCTGAACATTTGGGCTTTACATTTGAGTGTAACATTTGTAATAAGACATTTAAATACAAGGATGCTTTACGCAAGCACATGTCGGCTGAACATTTGGGCATTACGTTTCAGTGTAACATTTGTAATAAGACATTTAAACAGAAAAAATATTTACACCTCCACATGTCGGCTCAACATTTGGGCATTACATTTGAGTGCAACATTTGTAAGCAGACATTTAAATACAAGCGCTATTTACGCAGACACATGGCGGCTGTACATTGGGGCTTTAAGTCAACGCCCACTCAGTGTGAAATTTGCAAGAAGACATTTAAATACAAGGATACTTTACGCAATCACATGTCGGCTCAACATTTGGGCATTATATTTGAGTGCGACATTTGTAAGAAGACATTTAAATACAAGGATGCTTTACGCAAGCACATGTCGGCTGAACATTTGGGCTTTACATTTGAGTGTAACATTTGTAATAAGACATTTATAGAGAAAAAATATTTACACTACCACATGTCGGCTAAACATTTGGGCATTACAAATGAGTGCGAAATTTGTAAGAAGACATTTAAATACAAGGATACTATGCGCAAGCACATGTCGAGTGTACATTTGGGCTCCCTCAAAAATAGTGCATAA
Protein Sequence: MTTKEQLVVHERIHTGVKSYVCQKPYVCNVCNKRFTRKQCKERHMLTHTGIKSFQCSVCSKTFGQKHQLTSHMAVHNRERPYNCDICKKTFKYKYHMRLHISSVHLGIIFECDICKTTFKYKENIRQHMSAEHLGFTFECNICNKTFKYKDALRKHMSAEHLGITFQCNICNKTFKQKKYLHLHMSAQHLGITFECNICKQTFKYKRYLRRHMAAVHWGFKSTPTQCEICKKTFKYKDTLRNHMSAQHLGIIFECDICKKTFKYKDALRKHMSAEHLGFTFECNICNKTFIEKKYLHYHMSAKHLGITNECEICKKTFKYKDTMRKHMSSVHLGSLKNSA

Sequence clustering based on sequence similarity using MMseqs2