Stex012966.1
Basic Information
- Insect
- Sycophila texana
- Gene Symbol
- MAFK
- Assembly
- GCA_035582955.1
- Location
- JAWWEN010006339.1:2675-3502[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 3.4 4.5e+03 -1.5 0.0 48 62 16 30 14 32 0.79 2 2 5.7e-14 7.6e-11 42.7 6.7 3 64 68 129 66 130 0.95
Sequence Information
- Coding Sequence
- ATGACAGAGaatacttacattttaagcttggacccattcaaatccatcaaattattggatctgcagcttgaTACACTAAAggaCCCTTTATCTCCAGGACCATGTCTTGATATAAGTGACGATGAACTTGTTACAATTTCTGTAAGAGATTTAAatcgtcaattaaaattacgtgGATTAACGAGAGAAGAAATCTCACGTATGAAACAACGTCGTCGTACGCTAAAAAATAGGGGCTATGCTGCAAGCTGTCGTATTAAGAGAATCGAACAAAAAGATGAACTGGAGTCAGAAAAATCTCAAGAATATAGAGATATGGAGGCTATGCAAGAAGATAACAATAGAATGAGAGAAGAAATAGAATCTTGGCATTCAAAATACatggcattaaaaaaattcgctgctgaaaaaaaaattcacatacCCCATGACTTTGAAACCatgtaa
- Protein Sequence
- MTENTYILSLDPFKSIKLLDLQLDTLKDPLSPGPCLDISDDELVTISVRDLNRQLKLRGLTREEISRMKQRRRTLKNRGYAASCRIKRIEQKDELESEKSQEYRDMEAMQEDNNRMREEIESWHSKYMALKKFAAEKKIHIPHDFETM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00898520;
- 90% Identity
- iTF_00714128; iTF_00712601; iTF_01469409; iTF_01468577;
- 80% Identity
- -