Slit002462.1
Basic Information
- Insect
- Spodoptera litura
- Gene Symbol
- HLF_3
- Assembly
- GCA_002706865.1
- Location
- NW:16313-16981[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 7.3e-10 4.3e-07 29.7 7.7 2 46 45 89 44 96 0.90
Sequence Information
- Coding Sequence
- ATGTTCATCGTTACGTTGAGAGAGGCTGCCGTGACTGCTATAAAAGATCACCAAGGTGGCACTTTAGTCAGAAACAATCCGAACATGCGTCGCGCTGTGCGGTCGCAATCACACGCCGGCACCGCGGCGAAAGACGACGCCTACCGATGCACGCGCGAGAAGAACAACGCGGCGGCGAAGAAGAGCCGCGACCGGCGGAAGCTGCGCGAGATAGAACTGTCGGTGGAGGTGTCGTATTTGAAACAGCAGCTAGCGGCGCTCAAAGCGACGCTACGCTCCCGCGCCTGCACACACTGTCGCCGCTCCAGTTTGCGCTAG
- Protein Sequence
- MFIVTLREAAVTAIKDHQGGTLVRNNPNMRRAVRSQSHAGTAAKDDAYRCTREKNNAAAKKSRDRRKLREIELSVEVSYLKQQLAALKATLRSRACTHCRRSSLR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -