Sexi002680.1
Basic Information
- Insect
- Spodoptera exigua
- Gene Symbol
- CrebA
- Assembly
- GCA_011316535.1
- Location
- WNNL01000138.1:348-3793[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 9.2 1.1e+04 -3.2 0.3 38 46 11 19 9 20 0.60 2 2 9.9e-19 1.2e-15 57.6 10.9 2 63 37 98 36 106 0.92
Sequence Information
- Coding Sequence
- AAAGGGTCAACTGGGACACTGGTGTTAACAGAAGAAGAGAAACGCACATTACTTGCTGAAGGCTACCCAGTCCCGACCCGCCTGCCGCTTACCAAGGCAGAAGAAAAGTCTCTCAAGAAAATCaggaggaaaataaaaaataagATATCCGCACAAGAAAGCAGACGCAAAAAGAAGGAATACATGGACCAGCTGGAGAGGAAGGTGGAGATCCTGATATCCGAGAACACGGATTACAGGAAGAGGGTGGAGACGTTGGAGCAGAAGAACGCGAGCTTGCTGAGCCAGGTCGCCTCGCTGCAGGCCATGGTGGCGCGCGGCGCTCGCAAGTGA
- Protein Sequence
- KGSTGTLVLTEEEKRTLLAEGYPVPTRLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERKVEILISENTDYRKRVETLEQKNASLLSQVASLQAMVARGARK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01139978;
- 90% Identity
- iTF_01139978;
- 80% Identity
- -