Spin019246.1
Basic Information
- Insect
- Sphinx pinastri
- Gene Symbol
- -
- Assembly
- GCA_947568825.1
- Location
- OX387616.1:4800587-4804323[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 0.00078 0.064 14.4 0.1 1 23 123 145 123 145 0.94 2 9 2.2e-05 0.0018 19.2 0.7 2 23 213 234 212 234 0.96 3 9 1.5 1.2e+02 4.0 1.0 1 23 238 260 238 260 0.90 4 9 0.0001 0.0085 17.1 1.2 1 23 268 291 268 291 0.96 5 9 0.065 5.3 8.3 3.0 1 23 297 320 297 320 0.84 6 9 3e-05 0.0024 18.8 1.4 1 23 326 349 326 349 0.97 7 9 0.00011 0.0094 17.0 2.4 1 23 355 377 355 377 0.97 8 9 4.4e-07 3.6e-05 24.6 0.5 1 23 383 405 383 405 0.98 9 9 7.8e-05 0.0064 17.5 2.0 1 23 411 434 411 434 0.98
Sequence Information
- Coding Sequence
- ATGACAGTTGATGATGCAGTTGACAACAACTCCAATGATGATTGTCTTGATGATCCAACTGATGTGACTGATGATACAGATTTACAAATAAAAGAAGAACAGACGATCGCGGGAAATCTAAAGTCTTCTAAAGTGATGAAGAAAAAGACCATTGATGATATGAGAGCCAAGAAAGAACTCATGCTCCGGATAAAGAGAACTAAAGAGAAACTCAACAAGTTGAAGGAGAGAGATAAAACAGACCGGCCATTAGTGACTTTAGTGAAAAAGAAGAGCCACGTAGATAAAGAGTATAACGCTATTAACAACGCGATAACAatggttgagtgttcgtacgtctgtccgttcttcactatatacagcgattattactgtatatactgcaaggagatgttcaccgatgctgacgcactccgcgcgcataccctcgctcacgacccggcgacctacaaggatgttatagatgccaaaaagaatgttctagtagacgtcgacagaatcgactgtcggttatgtcaagcgaatatcgataacatcgattctttgaagtgtcatttaactaaaatacatggaaaaatcataagtgaagagaccaacaatgagttccttaagtttaaactgagaaccggaaaaatgacttgcacagaatgtggacggagctttaatttcttccaagcgttaagaaagcacatggctgaacattttggtacctacatctgtgacgtttgcggggcgcattactttgaagaacgactgttgacctttcacaagaagatacacaatccaatagacacaaaaaccttcacatgctccgagtgcgggaaaatcttcaaatcgaaaaaaagtcgttacttacacatagccaagatacatagaaacgaacctgcgtactcttgcaacaaatgcgacgaggtgtttttctcctaccatttaagatataaacataaaatcgaagagcacggcgagcaccgagttttcccctgcgagaactgcgacaaagtgtacaacagtaggaaatcgttaagggaacacaatagaaagaaccatttactgctacttaaacacgagtgcagtcaatgcgagaggaagttttaccttccatctcaactaaaggaccatatgacgtcacacactggggagaggaacttcaggtgtgagtactgtggtaagagttatccaagactaaaggctttaaaagttcatatggactcacacaatacagaaaagaggtataaatgcggcctgtgttcggcgtcttatacacagttgaacaattttaagaatcacatgaaaagtaaacatcAGTCTATGGAAAATGGTGATCAATTTTCATGA
- Protein Sequence
- MTVDDAVDNNSNDDCLDDPTDVTDDTDLQIKEEQTIAGNLKSSKVMKKKTIDDMRAKKELMLRIKRTKEKLNKLKERDKTDRPLVTLVKKKSHVDKEYNAINNAITMVECSYVCPFFTIYSDYYCIYCKEMFTDADALRAHTLAHDPATYKDVIDAKKNVLVDVDRIDCRLCQANIDNIDSLKCHLTKIHGKIISEETNNEFLKFKLRTGKMTCTECGRSFNFFQALRKHMAEHFGTYICDVCGAHYFEERLLTFHKKIHNPIDTKTFTCSECGKIFKSKKSRYLHIAKIHRNEPAYSCNKCDEVFFSYHLRYKHKIEEHGEHRVFPCENCDKVYNSRKSLREHNRKNHLLLLKHECSQCERKFYLPSQLKDHMTSHTGERNFRCEYCGKSYPRLKALKVHMDSHNTEKRYKCGLCSASYTQLNNFKNHMKSKHQSMENGDQFS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00858882; iTF_00859803;
- 90% Identity
- iTF_00859803;
- 80% Identity
- -