Basic Information

Insect: Solenopsis fugax
Gene Symbol: -
Assembly: GCA_003595255.1
Location: QKQZ01046144.1:6629-7597[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 1.2e-05 0.0018 19.4 1.8 1 23 44 66 44 66 0.97

2 9 0.00098 0.15 13.4 0.3 2 23 69 91 69 91 0.94

3 9 1.2 1.8e+02 3.7 0.9 1 23 96 119 96 119 0.89

4 9 0.00035 0.052 14.8 0.7 2 23 126 148 125 148 0.95

5 9 0.00047 0.071 14.4 0.9 3 23 155 176 154 176 0.95

6 9 0.00098 0.15 13.4 0.3 1 23 181 203 181 203 0.99

7 9 2e-05 0.0031 18.7 0.4 1 23 212 234 212 234 0.97

8 9 1.5e-05 0.0022 19.2 0.1 1 23 240 262 240 262 0.99

9 9 1.3e-06 0.00019 22.5 0.1 1 23 267 289 267 289 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	1.2e-05	0.0018	19.4	1.8	1	23	44	66	44	66	0.97
2	9	0.00098	0.15	13.4	0.3	2	23	69	91	69	91	0.94
3	9	1.2	1.8e+02	3.7	0.9	1	23	96	119	96	119	0.89
4	9	0.00035	0.052	14.8	0.7	2	23	126	148	125	148	0.95
5	9	0.00047	0.071	14.4	0.9	3	23	155	176	154	176	0.95
6	9	0.00098	0.15	13.4	0.3	1	23	181	203	181	203	0.99
7	9	2e-05	0.0031	18.7	0.4	1	23	212	234	212	234	0.97
8	9	1.5e-05	0.0022	19.2	0.1	1	23	240	262	240	262	0.99
9	9	1.3e-06	0.00019	22.5	0.1	1	23	267	289	267	289	0.99

Sequence Information

Coding Sequence: ATGGAGGGAATCAAGAGCGAAGGCATGCGGAATTCTCACGCATTCTTTATCGAGACGTCTTCGAGTATCGCCGAGATAATCAGCACGGATAGCAGTAAAGAGAACAGGAATGTAGTGAGACGCTTACATTACGCCTGCGACGTTTGCTCTTTCCCATGCCGGACGAAGGGAAATTTAAGAAAGCACATGCAGCTTCACAAGAACACGtgtaaaaactgcaacgaGCTGTTCGTCTCATCAGAGAAGCTAGAACTTCACATGGTTGTGCAGCACGGCGAGCCGAAGTACACCTGCAAACTGTGCTACTCCGTGATATGGAACAAGTCGGACATGAAGAAGCACTTCCTTGTGAGCCACTTAGATCCTTTCTGCAACACGTGCAACGCTTGCAATAAGGTGTTCCAATCGAAGTACGCTATAGAAAGGCACATGTACAGTCAACACACGAAGCTCTCGGTGGCGTGCACTATCTGTAGACGCGTCTATAACAGTTACCACGCGTTGAAAGCGCATACCAAGCTCATTCACTTGAAGACCGGTTACCAGTGCGAAATATGCAAGCGACGTCTCCTCTCTGTGGACTCTCTGGAGGCACACCTACGACGGCACGAAGGCTCGCGAAACATGGACAGTTACATCTGTACAACGTGCGGAGAGACTTTTCTCACTAAGAATAATCTGAACAAACACGTGATCATTCATGGTGAGAGTAATCCTTACGTTTGCCCGGTATGTCAGAAAGCCTTCGAAAAACGGGCGAATCAAGTGCAACATATTTTGACGCACATGAGTAACGTTTACGAGTGCGACATATGCGGACTGAGATATTCACGAAGAGCTGCTTTGATATGGCATAGGAAAATGCACCCTGGACCACTCGGGAAATTACCGGTCATACCCGTCATAGGCATTGTGAGCGAATTCGTTAAGAATTACATtagcaaaacaaaaaatttaccgAACACTTAA
Protein Sequence: MEGIKSEGMRNSHAFFIETSSSIAEIISTDSSKENRNVVRRLHYACDVCSFPCRTKGNLRKHMQLHKNTCKNCNELFVSSEKLELHMVVQHGEPKYTCKLCYSVIWNKSDMKKHFLVSHLDPFCNTCNACNKVFQSKYAIERHMYSQHTKLSVACTICRRVYNSYHALKAHTKLIHLKTGYQCEICKRRLLSVDSLEAHLRRHEGSRNMDSYICTTCGETFLTKNNLNKHVIIHGESNPYVCPVCQKAFEKRANQVQHILTHMSNVYECDICGLRYSRRAALIWHRKMHPGPLGKLPVIPVIGIVSEFVKNYISKTKNLPNT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00885378;
90% Identity: iTF_00885378;
80% Identity: -