Basic Information

Insect: Sisyra terminalis
Gene Symbol: -
Assembly: GCA_958496175.1
Location: OY292279.1:45231784-45233231[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 2e-05 0.0013 19.3 0.2 1 23 114 136 114 136 0.99

2 8 0.00047 0.031 14.9 0.1 1 23 141 163 141 163 0.98

3 8 1.1e-06 7.2e-05 23.2 0.3 1 23 169 191 169 191 0.98

4 8 0.00034 0.023 15.4 0.5 1 23 197 219 197 219 0.94

5 8 4e-06 0.00026 21.4 0.3 1 23 225 247 225 247 0.97

6 8 2.9e-05 0.0019 18.7 0.4 3 23 255 275 254 275 0.97

7 8 5.4e-06 0.00035 21.0 0.5 1 23 281 303 281 303 0.96

8 8 8.1e-05 0.0054 17.3 1.1 1 19 309 327 309 329 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	2e-05	0.0013	19.3	0.2	1	23	114	136	114	136	0.99
2	8	0.00047	0.031	14.9	0.1	1	23	141	163	141	163	0.98
3	8	1.1e-06	7.2e-05	23.2	0.3	1	23	169	191	169	191	0.98
4	8	0.00034	0.023	15.4	0.5	1	23	197	219	197	219	0.94
5	8	4e-06	0.00026	21.4	0.3	1	23	225	247	225	247	0.97
6	8	2.9e-05	0.0019	18.7	0.4	3	23	255	275	254	275	0.97
7	8	5.4e-06	0.00035	21.0	0.5	1	23	281	303	281	303	0.96
8	8	8.1e-05	0.0054	17.3	1.1	1	19	309	327	309	329	0.95

Sequence Information

Coding Sequence: ATGGAGGAAAACATCGAGGGAAAAGGGAGTAAAGGTCCAATCACACGTGCCGATATTTCCAAGCCAACTACGATCGATTATTCCACcattaaatatcaaaatgatATTGATTCGGAAATTTCAGAAGAAACTGGTAAACAATTAGATAATATTGCCCTTGAAAATTGGGaaccaaatgaaaatttgaatactaCAATAGAAGAAACAAATGATGTTCATATTAAATCCGAAATTGAAGTGGATGAGGGAATTTTCGCCCTGAATGTTGGTAACCATTTAACAAGTGGCACCACTGTCGAATCTCCCGAAcggaatttcaaaattttgcgAGTGAAAACCTATCGTTGTCCAGTTTGTGCCAAAGCCTTTGAATACAATAACGTTTTGCAGCGCCATTTAAAAATTCACGCTCAAAAGCcatacgtttgtgatgtttgtaATAAATCAATGGCTCTTCTATCAGAATTAAAGATTCATCAGATGATACACAGAGGTGAAAAGCCGttcgtttgtgatgtttgtgataTGAAATTTGCTCGTAAATCCGATTTAAGGGTTCATAAAATGGTACATAGTGGTGAAAAACcgtacgtttgtgatgtttgtaataaatcatttcgTCGTATAATAGAATTAGATTACCATAAAGTTAAACATACTGGTGAAAAGCcatacgtttgtgatgtttgtgataaatcatttactcAAAAGATAGGATTACAAGATCATAATTTGAGACACACTGGTGTAAAACCGCACggttgtgatgtttgtgataaagttttttttcgcaaaactGATTTAACGGCTCATAAATTGTTACACACGGGTGAAAAGCCGTACGTTTGTGATTTTTGCAataAATCTTTTGCAACTAAGGCATACTTGCAAATACATAAAGTGGTGCACACTGGTGAAAGGCcgcacgtttgtgatgtttgtaATAGATCGTTCACTTTTAAACAAGCTTTAAAACGACATAAAGTTTGTCATACGCGTGAAAAATCGTCCGTAATCGACAGTGGtgacaaaagttaa
Protein Sequence: MEENIEGKGSKGPITRADISKPTTIDYSTIKYQNDIDSEISEETGKQLDNIALENWEPNENLNTTIEETNDVHIKSEIEVDEGIFALNVGNHLTSGTTVESPERNFKILRVKTYRCPVCAKAFEYNNVLQRHLKIHAQKPYVCDVCNKSMALLSELKIHQMIHRGEKPFVCDVCDMKFARKSDLRVHKMVHSGEKPYVCDVCNKSFRRIIELDYHKVKHTGEKPYVCDVCDKSFTQKIGLQDHNLRHTGVKPHGCDVCDKVFFRKTDLTAHKLLHTGEKPYVCDFCNKSFATKAYLQIHKVVHTGERPHVCDVCNRSFTFKQALKRHKVCHTREKSSVIDSGDKS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -