Basic Information

Insect: Sipha maydis
Gene Symbol: -
Assembly: GCA_034509805.1
Location: JASXSY010000242.1:410343-411509[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00097 0.18 13.5 0.1 1 21 103 123 103 124 0.96

2 8 2.8e-06 0.00052 21.5 0.9 2 23 185 207 184 207 0.96

3 8 2.6e-06 0.00049 21.6 1.0 3 23 214 235 213 235 0.96

4 8 1.8e-06 0.00033 22.1 0.5 1 23 241 264 241 264 0.97

5 8 3.1e-05 0.0057 18.2 1.7 1 23 272 295 272 295 0.96

6 8 0.0054 0.99 11.2 0.1 1 23 301 324 301 324 0.91

7 8 1.1e-08 2.1e-06 29.1 0.9 1 23 334 356 334 356 0.95

8 8 2.5e-05 0.0045 18.5 1.5 1 21 363 383 363 384 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00097	0.18	13.5	0.1	1	21	103	123	103	124	0.96
2	8	2.8e-06	0.00052	21.5	0.9	2	23	185	207	184	207	0.96
3	8	2.6e-06	0.00049	21.6	1.0	3	23	214	235	213	235	0.96
4	8	1.8e-06	0.00033	22.1	0.5	1	23	241	264	241	264	0.97
5	8	3.1e-05	0.0057	18.2	1.7	1	23	272	295	272	295	0.96
6	8	0.0054	0.99	11.2	0.1	1	23	301	324	301	324	0.91
7	8	1.1e-08	2.1e-06	29.1	0.9	1	23	334	356	334	356	0.95
8	8	2.5e-05	0.0045	18.5	1.5	1	21	363	383	363	384	0.92

Sequence Information

Coding Sequence: ATGTCCGGGAACGAGGCCGCCGGGGAGACGTTGGTCGGGAACCACTGCGACGCGACTCGAGCGTCCGGGAGTGGCAAGACCGCGAGGAGCACGCGACGCGCGTCCGCGCAGCTATGGATCAGCAAATGGTACGAATCGGACGACACAGATCGGGAACCGTCGCCGTGCTCGTCTACCTCGTGGTCGCCTCCGCGCGCGCAGCGGTCGCCGTCCATTTCGATGTCGCCGTGCCGTTCGATGACGCCGTGCGGTTCGTTGTCGCCGttgccgtcgccgccgccgagGCTCGACTCGCCGTCCGTGGAGTTCGAGTGCGCCGTGTGTTCGGAGGCGTTCCAGACGAAGGCCGAGATGAAAACGCACATGCAACAGTCGGTGGGTTGCGGTAAACAAGTGCTGAGAGCGTTCCGCTCCAAGTGCGACGAGTTCGATCAGGAGTTCGCGAATCAAGATGACGTGGAACAGCGCCGGGACACCGAACACCGCGAGTCGCCGGGGAAACAACAGCGACAAGATCTGCCGGAGCAGTCGGAACAGCCGAAACGACAGTTGACGTGCCACATTTGCGAGCGGATTTTCAACCGGGCCGACCAACTGGCCGTGCACTTGCGCCGCAAACACGGTCGCCCTGATGTTGACTGCGAGACGTGCGGCCAACGGTTCAGCCGGCGCACTGACCTGAACCGGCACCGTCGCGCCGTGCACCTGCGCCAGCGGCCGTACCAGTGCTACGACTGCGGGCAGCGGTTCGCGCAAAAGTCCAACATGCTGGAGCACCGGCGCGCCGTGCACGCGGCCAACCCGAAGGTGGCGTTCAAGTGCCCGCGGTGCGACAAGTGGTTCTCGCGCAAACACAACATGACCGTGCACGTGCGGGCCGTGCACGACAGGCAAAAGCGGTTCAAGTGCCCGTCGTGCCCGCGATCGTACGACGAGCAGTCCGCGGTCGACAAGCACTACGCAGCGCTGCACGCGCCCCCCACCGATGGCGTGCCGCTGTTTCTGTGCCCGGTGTGTGGCAAGCGTTTCTCCCAGAAGTCCAACCTCACCGTGCACCGGCGGTTGCACGACCCCATTCAGTTGCTGTTCGCGTGCCCCGTGTGTCACAGGTCTTACACCCGCAAGGCGGCGCTCAACAAGCATGCCTGTCGCCCCGTCGAAACGTGA
Protein Sequence: MSGNEAAGETLVGNHCDATRASGSGKTARSTRRASAQLWISKWYESDDTDREPSPCSSTSWSPPRAQRSPSISMSPCRSMTPCGSLSPLPSPPPRLDSPSVEFECAVCSEAFQTKAEMKTHMQQSVGCGKQVLRAFRSKCDEFDQEFANQDDVEQRRDTEHRESPGKQQRQDLPEQSEQPKRQLTCHICERIFNRADQLAVHLRRKHGRPDVDCETCGQRFSRRTDLNRHRRAVHLRQRPYQCYDCGQRFAQKSNMLEHRRAVHAANPKVAFKCPRCDKWFSRKHNMTVHVRAVHDRQKRFKCPSCPRSYDEQSAVDKHYAALHAPPTDGVPLFLCPVCGKRFSQKSNLTVHRRLHDPIQLLFACPVCHRSYTRKAALNKHACRPVET

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01346631;
90% Identity: -
80% Identity: -