Sflv000886.1
Basic Information
- Insect
- Sipha flava
- Gene Symbol
- -
- Assembly
- GCA_003268045.1
- Location
- NW:18171-18952[-]
Transcription Factor Domain
- TF Family
- MYB
- Domain
- Myb_DNA-binding domain
- PFAM
- PF00249
- TF Group
- Helix-turn-helix
- Description
- This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.1e-08 7.3e-06 25.5 2.9 4 45 7 64 5 65 0.87
Sequence Information
- Coding Sequence
- ATGtcgaaaaaatttgttttttcctcAACTGAGgacgaaattttaattgaatatgtcCAACAAAATAGGGAAATTTTTGACAGTGCTCACCCTAAGCATAAAgatattcattttaaagaaaaaatttggaaaattttttctgaaaaagtCGGTAGAACAGatgaaGACTGCAAAAAAAGGTGGAGGAACATAAGAGATACATAtatgaaacagaaaaaaaaactatcgacTGGTTTAGCAACTTCTGAAAAAGTGAATAGGACACTGTCATACTTATCGTTTATGGATTCAGTTGAATACGAGAgaaagacTACATCAAACGtcaaaaaatcaagaaaatga
- Protein Sequence
- MSKKFVFSSTEDEILIEYVQQNREIFDSAHPKHKDIHFKEKIWKIFSEKVGRTDEDCKKRWRNIRDTYMKQKKKLSTGLATSEKVNRTLSYLSFMDSVEYERKTTSNVKKSRK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -