Basic Information

Insect: Sialis fuliginosa
Gene Symbol: -
Assembly: GCA_961205875.1
Location: OY540819.1:16824139-16825128[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0079 0.42 11.3 2.1 1 23 81 103 81 103 0.98

2 9 0.0013 0.07 13.8 0.8 1 23 109 131 109 131 0.98

3 9 0.00052 0.028 15.0 2.5 1 23 137 159 137 159 0.99

4 9 0.00049 0.026 15.1 0.6 1 23 165 187 165 187 0.98

5 9 0.0015 0.081 13.6 4.7 1 23 193 215 193 215 0.99

6 9 0.0012 0.063 13.9 1.0 1 23 221 243 221 243 0.97

7 9 0.0014 0.076 13.6 0.9 1 23 249 271 249 271 0.98

8 9 9.6e-06 0.00051 20.5 3.7 1 23 277 299 277 299 0.98

9 9 0.45 24 5.8 5.7 1 23 305 327 305 327 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0079	0.42	11.3	2.1	1	23	81	103	81	103	0.98
2	9	0.0013	0.07	13.8	0.8	1	23	109	131	109	131	0.98
3	9	0.00052	0.028	15.0	2.5	1	23	137	159	137	159	0.99
4	9	0.00049	0.026	15.1	0.6	1	23	165	187	165	187	0.98
5	9	0.0015	0.081	13.6	4.7	1	23	193	215	193	215	0.99
6	9	0.0012	0.063	13.9	1.0	1	23	221	243	221	243	0.97
7	9	0.0014	0.076	13.6	0.9	1	23	249	271	249	271	0.98
8	9	9.6e-06	0.00051	20.5	3.7	1	23	277	299	277	299	0.98
9	9	0.45	24	5.8	5.7	1	23	305	327	305	327	0.98

Sequence Information

Coding Sequence: ATGATTCgtataaaaacagaaaatattaaagaaGAGCTACAAGATGGTGAATTTGATCAAGAACAATCTATTTGTAAAGAAGAAATAGAGCAAAAAATTTCCTTCGAACAAGTTTATTTACCAGTATTTGTGAAAGAGGAATGCTGTTCAACCAACGAAAATGAGAGTAATTCTACATTTCAAGAAGGTGATGTATCTGAACTCTGTTCTAAAGTACAAACAAGTGATCAAGAACATCTGTATAAATGCGATCAGTGCGAATATGGCACTATTTATGAGTATAAATTGAAAACACATAAAATGAAACACGCTGgtaaacgaccttttaaatgcaatcgATGTGAATATAGCACCGTTACTTCAGCATTGTTGAATTTACATGAGAAGAATCACACATACGATAGACCATTTAAATGTGATGTATGTGGTTATAGATCCAAATGTAAGAGTGCTTTAATGATGCACATGATGACACACACTTGCGAAcgcccttttaaatgcaaccaatgtGAATTCACATCTACATTAAAAGGTACTTTAAAGGTGCATATGGCAATTCATACTTCTGAACGGCCTTACAAATGCGACGAATGTGATTATACAACAAGGTACAACATTTGTTTGAAACAACATAAAATGagacatactaatgaaagaccgtTTAAATGTAATTACTGTGAATTCAGTACAGTTGGGAAAAGTCTGTTAAAATTACATGAAATTAAACATACTAGCGAACTTCCTTACAAATGTGATCAATGTGAGTATAGCACCAATATTAAGGCCAATTTAACACTTCATGGGAAGAAACATTCAAGTGAGAAACCTTTTAGATGTGATATTTGTGAGTATAGTTGTAAAAGTAAAGGTAATTTGAAATCACACAAGAGAGTACATACCAGTGAATGCCCTTACAAATGCGATCAATgtgaatttaaaacaaaatgtaaGCAATATTTAAAACAACACATTATAAAGCATACGAAATGA
Protein Sequence: MIRIKTENIKEELQDGEFDQEQSICKEEIEQKISFEQVYLPVFVKEECCSTNENESNSTFQEGDVSELCSKVQTSDQEHLYKCDQCEYGTIYEYKLKTHKMKHAGKRPFKCNRCEYSTVTSALLNLHEKNHTYDRPFKCDVCGYRSKCKSALMMHMMTHTCERPFKCNQCEFTSTLKGTLKVHMAIHTSERPYKCDECDYTTRYNICLKQHKMRHTNERPFKCNYCEFSTVGKSLLKLHEIKHTSELPYKCDQCEYSTNIKANLTLHGKKHSSEKPFRCDICEYSCKSKGNLKSHKRVHTSECPYKCDQCEFKTKCKQYLKQHIIKHTK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -