Basic Information

Insect: Shargacucullia verbasci
Gene Symbol: -
Assembly: GCA_947562105.1
Location: OX387309.1:2495070-2498730[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 4.1e-05 0.0031 18.2 0.0 1 23 250 273 250 273 0.96

2 10 2.7 2e+02 3.0 0.3 2 23 299 321 298 321 0.86

3 10 0.0061 0.47 11.3 1.8 1 23 344 366 344 366 0.97

4 10 7.8e-06 0.00059 20.4 0.7 1 23 370 392 370 392 0.98

5 10 0.01 0.78 10.6 6.6 1 23 397 420 397 420 0.93

6 10 0.0076 0.58 11.0 0.6 3 23 429 450 427 450 0.93

7 10 2.8e-05 0.0021 18.7 1.0 1 23 456 479 456 479 0.98

8 10 6.5e-05 0.0049 17.5 3.3 2 23 486 507 485 507 0.96

9 10 2.4e-07 1.8e-05 25.2 1.9 1 23 513 535 513 535 0.98

10 10 9.1e-06 0.00069 20.2 2.6 1 23 541 564 541 564 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	4.1e-05	0.0031	18.2	0.0	1	23	250	273	250	273	0.96
2	10	2.7	2e+02	3.0	0.3	2	23	299	321	298	321	0.86
3	10	0.0061	0.47	11.3	1.8	1	23	344	366	344	366	0.97
4	10	7.8e-06	0.00059	20.4	0.7	1	23	370	392	370	392	0.98
5	10	0.01	0.78	10.6	6.6	1	23	397	420	397	420	0.93
6	10	0.0076	0.58	11.0	0.6	3	23	429	450	427	450	0.93
7	10	2.8e-05	0.0021	18.7	1.0	1	23	456	479	456	479	0.98
8	10	6.5e-05	0.0049	17.5	3.3	2	23	486	507	485	507	0.96
9	10	2.4e-07	1.8e-05	25.2	1.9	1	23	513	535	513	535	0.98
10	10	9.1e-06	0.00069	20.2	2.6	1	23	541	564	541	564	0.97

Sequence Information

Coding Sequence: ATGGAATTGGTTGGTGTTTGCCGCTGCTGCCTTACCCAGGGCTTAAACAAGGACTTGCATTCAAGTTACCTATGGCTTGATAAAAAAGAGATTTATTCTGACATGTTGCAAGAATGTTTCAATATAATTCTGACACCAGCGGACAAGAAATCTACCGGTATCTGTGAGACATGCATCAAGAACCTTCGCAGCTCGTTCAACTTTAAGCGGCAAGTCTTGAGCTCTGAGAGGGAATTTACAAAGAAGCTGAAACACCTAGTTATTGGAAAAGATGAAATGAAATTTGAAGTGAAATTGGAGCCAAAGCCGGAGGACCCTGGCAATGAGTCTGATGATTATTTCCTATCAACTGTTGGCGATACCACCATAAAGAAAATAAAGATAGAAAAAGAAATGCCTGTCAAAAAGAAAACAGAAAAGCGCAGTAAAGTGAAGGCAATGAAGAAGTCTCTCACACCAACACCCTCTGAGACCAACTGGAAGAACGACAAGATTAAAACTTTGGTGTCCAGACTTGCTACTTCCATCAAAACCTGTGATATGCCAGATGTAAAACCAACAAAATCAGAAACAAAGTCAAGACCCCGACTGAGACTGTCCGTCCCAAAAGAACCCTTTGCTAATCCAAACTCCAAACTAAGCATCATGTGGAGAACAAGCACAGACAAAATAAAACACAAGGAGGACCTTCAAACCatactaaagttctccaacgttactccgttcaaaaacaaaacgttactcggttacttatgtgggtattgtgacacaccgttccctgatccagcagatttgagactccataccaaaacagaacataagaatgaccgaatgaactttaaacctcacttcgatatgacagaatacaacgtcaaagttgacatcgttgacttgagttgtacaatatgcgatgaaaagatgaacactttaaccattttgagagaacatttagcgaagaagcataacaaaaccattcacaacgatattaaagatcatatcacacagtttaagttaaaaaaaggagatgtctatgattgtgctatgtgtacatcgacgtatgagacttttaaaatgttaaaacaacatatgaacaagcattatagcaactatacttgtgccaaatgtgatgcttcgtttgctaccaaaagatctttgaacgctcacagaacaacgcaccaagaagggagttttaagtgtgatcattgtgacaaagtcttctcaagcaaaccaaaaaagcattaccatgagaagatgaagcatttaggagcaagaaacatatcaaattgtccgttctgcaacgaaccgttccgcagttactatcaacggaaccaacatttagtgaaagttcacaattcagaagctcaatataagtgcaatgtgtgtaacaaggcgtatattttgaagagtttgttgatgtatcatattaaaaaaagtcatttgatggaacgaaactgtcagtgtaccgagtgcgggttccgtttcttcagcaaaaaggctttgaaggcccatatggtcaagcataccggggagaggatttatgcttgtgagatatgccataagtcatatgcaaggaagtatactttaagggagcatatgcggatacataacaacgatagacggttcaaatgtgaagtgtgtgggacaacgtttgtgcagaagtgcagcttgaaaagtcatttgctatccaaccatgggattagtttgGCTGCTTCGGCCATAACATCCACTTAA
Protein Sequence: MELVGVCRCCLTQGLNKDLHSSYLWLDKKEIYSDMLQECFNIILTPADKKSTGICETCIKNLRSSFNFKRQVLSSEREFTKKLKHLVIGKDEMKFEVKLEPKPEDPGNESDDYFLSTVGDTTIKKIKIEKEMPVKKKTEKRSKVKAMKKSLTPTPSETNWKNDKIKTLVSRLATSIKTCDMPDVKPTKSETKSRPRLRLSVPKEPFANPNSKLSIMWRTSTDKIKHKEDLQTILKFSNVTPFKNKTLLGYLCGYCDTPFPDPADLRLHTKTEHKNDRMNFKPHFDMTEYNVKVDIVDLSCTICDEKMNTLTILREHLAKKHNKTIHNDIKDHITQFKLKKGDVYDCAMCTSTYETFKMLKQHMNKHYSNYTCAKCDASFATKRSLNAHRTTHQEGSFKCDHCDKVFSSKPKKHYHEKMKHLGARNISNCPFCNEPFRSYYQRNQHLVKVHNSEAQYKCNVCNKAYILKSLLMYHIKKSHLMERNCQCTECGFRFFSKKALKAHMVKHTGERIYACEICHKSYARKYTLREHMRIHNNDRRFKCEVCGTTFVQKCSLKSHLLSNHGISLAASAITST

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00050191;
90% Identity: iTF_00050191;
80% Identity: -