Scos015280.1
Basic Information
- Insect
- Schrankia costaestrigalis
- Gene Symbol
- CrebA_1
- Assembly
- GCA_905475405.1
- Location
- FR997834.1:14522687-14524062[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2e-19 4.4e-16 59.9 10.7 2 63 38 99 37 101 0.95 2 2 0.0002 0.44 11.9 0.6 32 53 82 103 80 107 0.91
Sequence Information
- Coding Sequence
- atgAAAGGCTCAACCGGTACGTTGGTACTGACAGAGGAAGAGAAACGCACATTACTAGCTGAAGGCTACCCCGTACCTACACGCCTGCCACTCACGAAAGCCGAAGAGAAATCACTCAAGAAGATCAGAAGGAAAATCAAAAATAAgATATCCGCGCAAGAAAGTAGACGCAAAAAGAAAGAATACATGGACCAATTGGAAAGAAAGGTAGAGGTCCTCATCTCTGAGAATACGGACTACAGAAAGAGAGTTGAGTCTCTAGAACAGAAGAACGCGACCCTTCTGACCCAGGTAGCGTCCCTCCAAGCCATAGTGGCGCGTGGTACCAGGAAGTGA
- Protein Sequence
- MKGSTGTLVLTEEEKRTLLAEGYPVPTRLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERKVEVLISENTDYRKRVESLEQKNATLLTQVASLQAIVARGTRK*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01139978;
- 90% Identity
- -
- 80% Identity
- -