Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.44 48 5.9 4.4 2 23 51 73 50 73 0.94

2 7 5.6e-05 0.0062 18.1 2.9 1 23 83 106 83 107 0.97

3 7 0.0045 0.5 12.1 1.0 5 23 116 135 114 135 0.94

4 7 0.077 8.4 8.3 0.6 6 23 149 167 148 167 0.98

5 7 0.0029 0.32 12.8 0.9 6 23 178 196 176 196 0.93

6 7 2.1e-05 0.0023 19.5 2.1 1 23 208 231 208 231 0.98

7 7 0.00043 0.047 15.4 1.1 6 23 242 259 238 259 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.44	48	5.9	4.4	2	23	51	73	50	73	0.94
2	7	5.6e-05	0.0062	18.1	2.9	1	23	83	106	83	107	0.97
3	7	0.0045	0.5	12.1	1.0	5	23	116	135	114	135	0.94
4	7	0.077	8.4	8.3	0.6	6	23	149	167	148	167	0.98
5	7	0.0029	0.32	12.8	0.9	6	23	178	196	176	196	0.93
6	7	2.1e-05	0.0023	19.5	2.1	1	23	208	231	208	231	0.98
7	7	0.00043	0.047	15.4	1.1	6	23	242	259	238	259	0.97

Coding Sequence: ATGCTTGCACACATCGGTGATGTTCACAGCAAGAAAATATCTAAGGTTGGATTATGCGGAAAGCAATCCAAGAGCGTGTCGATTCTTAAACGACTGCTGCTTTTAcccaaatttaagaaaataccaAATCAAGTAACTCCAGACAGTGTACAATGTAAATATTGCAATGTATATTTCGaacatagatatatattttataaacatatggAGCTTTGTCATACTGGTAAGGAAGATGAGAAAAAGGAATTTAAATGTGAGTCATGTGAGCGTGTGTATAAAAGCAAACAGACTTtgacaatacatataaaaaagattcaTCATGATTATGGAAGAATGTTCGAGTGTTGGTGCGGGGAGCAGTTCCGTTCGCCAATACATTTGAGAGAACACAAGAGATTACGGCATGTTATCAACAGAAAAACTGAACTATACGCATGCATTTGTTGCGACGCGAAATTTAATTCGAAAATGTATTTAGATGCGCatataaaaagaaatcattATGATTATGGGAGAACGTTTgtatgttggtgcgggaaagaTTTTCGAACGCCAATACACTTACGCGAGCATAAAGCTCGTCTACACGATGGCAACAGTAAAGATACAAATAATGAGAAATTTCAATGTGACTTTTGCCACAGGGGTTTCGAgagcaaaatttatttaataaagcatATAAAAAGTGTTCATTATGATTACGGTAGAGTGTTTGAATGTCCGTGTGGGAAAAAGTTCCGAACGCCGAGATACTTACGGGATCATAAAAATCGGCACTGTTGTCGCCAGCATAGCACATGA
Protein Sequence: MLAHIGDVHSKKISKVGLCGKQSKSVSILKRLLLLPKFKKIPNQVTPDSVQCKYCNVYFEHRYIFYKHMELCHTGKEDEKKEFKCESCERVYKSKQTLTIHIKKIHHDYGRMFECWCGEQFRSPIHLREHKRLRHVINRKTELYACICCDAKFNSKMYLDAHIKRNHYDYGRTFVCWCGKDFRTPIHLREHKARLHDGNSKDTNNEKFQCDFCHRGFESKIYLIKHIKSVHYDYGRVFECPCGKKFRTPRYLRDHKNRHCCRQHST

Sequence clustering based on sequence similarity using MMseqs2