Sjap031641.1
Basic Information
- Insect
- Saturnia japonica
- Gene Symbol
- PRDM15
- Assembly
- GCA_033032175.1
- Location
- CM065329.1:9610992-9612176[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 12 0.0039 0.43 12.3 1.5 1 23 3 26 3 26 0.98 2 12 0.00061 0.067 14.9 1.3 6 23 37 55 35 55 0.95 3 12 0.22 24 6.8 1.2 7 23 73 90 68 90 0.91 4 12 0.00044 0.048 15.3 0.7 6 22 101 117 99 117 0.94 5 12 4.1e-05 0.0045 18.6 0.6 1 23 126 149 126 149 0.96 6 12 4.9e-05 0.0054 18.3 0.9 6 23 160 178 158 178 0.96 7 12 6.3e-06 0.00069 21.1 3.4 1 23 190 213 190 213 0.97 8 12 0.0023 0.26 13.0 0.4 6 22 224 240 222 240 0.94 9 12 4.1e-05 0.0045 18.6 0.6 1 23 249 272 249 272 0.96 10 12 4.9e-05 0.0054 18.3 0.9 6 23 283 301 281 301 0.96 11 12 6.3e-06 0.00069 21.1 3.4 1 23 313 336 313 336 0.97 12 12 0.00061 0.067 14.9 1.3 6 23 347 365 345 365 0.95
Sequence Information
- Coding Sequence
- atgaaatataaatgtgaCTCATGTGAAGGTACTTATAGAAGTAAACGTTCTTTAAGTGAGCATGTAAAGAGAACTCATTACGATTACGGGAGAACGTTtgattgttggtgcgggaaacagttccgtacacCAATAAACTTATGTGGACATATGAAGCGACAGCATGATGGCAAAATGAAAAGTACAAATAGAGACAAAGTTCAATGTGACACTTAccataaaaatttcataagcaAAGACTGTTTATCAAAGCACATAAAAAAtatgcattatgattatggtaaagtatttgattgttggtgcgggaaacagttcagTACACCAAAACAGCTGAGAAACCACAAGAGAACACCATGTGGTGCTAAAAATGAAGTGTACAAATGTGAATTCTGCAAGGCGGTGTTTAATGCGAAGGCGAATTTAACAAGACATTTAAAGGGTATGCATTATGATTACGGGAGAACGTTtgattgttggtgcgggaaacagttccgtacacCAACACTCTTACGTATACATATGAGGCGGCAGCATGATGGCAAAATGAACGATACAAATAGAGACAAATTTCAATGTGACACTTGccataaaaatttcataaacaaagactaTTTATCAAAGCATATAAAAAATgtgcattatgattatggtaaagtatttgattgttggtgcgggaaacagttccgtacacCAAAACTGTTGGAAAGCCACAAGAGAACACTATGTGGTGCTAAAAATGAAGTGTACAAATGTGAATTCTGCAAGGCGGTGTTTAATGCAAAGGCGAATTTAACAAGACATTTAAAGGGTATGCATTATGATTACGGGAGAATGTTtgattgttggtgcgggaaacagttccgtacacCGACACTCTTACGTATACATATGAGGCGGCAGCATGATGGCAAAATGAACGATACAAATAGAGACAAATTTCAATGTGACACTTGccataaaaatttcataaacaaagactaTTTATCAAAGCATATAAAAAATgtgcattatgattatggtaaagtatttgattgttggtgcgggaaacagtttcgTACACCGATAAACTTATGTGGACATATGAAGCGACAGCATGATGGCAAAATAAAAGATAGAAATAACGACACAGTTCAATTCAAGGCCCGATGTAGTCCAGAGAAGCTTAAATTAGGGGCGGCAAATTGA
- Protein Sequence
- MKYKCDSCEGTYRSKRSLSEHVKRTHYDYGRTFDCWCGKQFRTPINLCGHMKRQHDGKMKSTNRDKVQCDTYHKNFISKDCLSKHIKNMHYDYGKVFDCWCGKQFSTPKQLRNHKRTPCGAKNEVYKCEFCKAVFNAKANLTRHLKGMHYDYGRTFDCWCGKQFRTPTLLRIHMRRQHDGKMNDTNRDKFQCDTCHKNFINKDYLSKHIKNVHYDYGKVFDCWCGKQFRTPKLLESHKRTLCGAKNEVYKCEFCKAVFNAKANLTRHLKGMHYDYGRMFDCWCGKQFRTPTLLRIHMRRQHDGKMNDTNRDKFQCDTCHKNFINKDYLSKHIKNVHYDYGKVFDCWCGKQFRTPINLCGHMKRQHDGKIKDRNNDTVQFKARCSPEKLKLGAAN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -