Basic Information

Transcription Factor Domain

TF Family: zf-GATA
Domain: zf-GATA domain
PFAM: PF00320
TF Group: Zinc-Coordinating Group
Description: This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 12 0.023 59 3.5 0.0 23 34 3 14 2 16 0.89

2 12 0.02 51 3.8 0.0 23 34 17 28 14 30 0.88

3 12 0.022 56 3.6 0.0 23 34 31 42 29 44 0.89

4 12 0.041 1e+02 2.8 0.1 23 33 51 61 45 64 0.86

5 12 0.0064 16 5.3 0.1 23 34 65 76 62 78 0.91

6 12 0.0092 23 4.8 0.0 23 35 79 91 76 92 0.90

7 12 0.026 65 3.4 0.0 23 34 93 104 93 106 0.88

8 12 0.02 51 3.8 0.0 23 34 107 118 104 120 0.88

9 12 0.02 51 3.8 0.0 23 34 121 132 118 134 0.88

10 12 0.046 1.2e+02 2.6 0.0 23 33 135 145 132 148 0.85

11 12 0.098 2.5e+02 1.5 0.0 23 34 149 160 146 162 0.86

12 12 0.095 2.4e+02 1.6 0.0 23 34 163 174 160 176 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	12	0.023	59	3.5	0.0	23	34	3	14	2	16	0.89
2	12	0.02	51	3.8	0.0	23	34	17	28	14	30	0.88
3	12	0.022	56	3.6	0.0	23	34	31	42	29	44	0.89
4	12	0.041	1e+02	2.8	0.1	23	33	51	61	45	64	0.86
5	12	0.0064	16	5.3	0.1	23	34	65	76	62	78	0.91
6	12	0.0092	23	4.8	0.0	23	35	79	91	76	92	0.90
7	12	0.026	65	3.4	0.0	23	34	93	104	93	106	0.88
8	12	0.02	51	3.8	0.0	23	34	107	118	104	120	0.88
9	12	0.02	51	3.8	0.0	23	34	121	132	118	134	0.88
10	12	0.046	1.2e+02	2.6	0.0	23	33	135	145	132	148	0.85
11	12	0.098	2.5e+02	1.5	0.0	23	34	149	160	146	162	0.86
12	12	0.095	2.4e+02	1.6	0.0	23	34	163	174	160	176	0.86

Coding Sequence: atgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcgggtacggtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacagtatgcggtgtacggtatgcggtgtacggtatgcgttgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtttgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacagtatgcggtgtacgctatgcagtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacggtatgcggtgtacagtatgcggtgtacggtatgcggtgtacagtatgcggtgtacggtatgcggtgtacagtatgcggtgtacggtatgcggtgtacggtatgcggtgtacagtatgcggtgtacggtatgcggtgtacgccttagcaacgtgttgtggtaatagtacagtagtatatgttacggtaa
Protein Sequence: MRCTVCGVRYAVYGMRCTVCGVRYAVYGMRCTVCGVRYAVYGMRVRYGMRCTVCGVRYAVYSMRCTVCGVRYALYGMRCTVCGVRYAVYGLRCTVCGVRYAVYGMRCTVCGVRYAVYGMRCTVCGVRYAVYGMRCTVCGVRYAVYSMRCTVCGVQYAVYGMRCTVCGVQYAVYGMRCTP*QRVVVIVQ*YMLR

Sequence clustering based on sequence similarity using MMseqs2