Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 1e-06 6.8e-05 23.3 3.9 3 23 174 194 172 194 0.97

2 6 3.8e-05 0.0025 18.3 0.4 1 23 199 222 199 222 0.94

3 6 0.0018 0.12 13.1 1.7 2 19 228 245 227 250 0.92

4 6 0.0013 0.087 13.5 0.6 3 23 255 275 254 275 0.97

5 6 0.25 16 6.3 2.2 2 20 279 297 278 299 0.80

6 6 0.00011 0.0072 16.9 0.5 1 22 310 331 310 331 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	1e-06	6.8e-05	23.3	3.9	3	23	174	194	172	194	0.97
2	6	3.8e-05	0.0025	18.3	0.4	1	23	199	222	199	222	0.94
3	6	0.0018	0.12	13.1	1.7	2	19	228	245	227	250	0.92
4	6	0.0013	0.087	13.5	0.6	3	23	255	275	254	275	0.97
5	6	0.25	16	6.3	2.2	2	20	279	297	278	299	0.80
6	6	0.00011	0.0072	16.9	0.5	1	22	310	331	310	331	0.94

Coding Sequence: atgaacacaaaaattgatgtaactcttccagctctaaaatttgtaactggtgatactgaacacatatgtaggttatgtttttcttcaaccgagagtgaagaaatatccattgaagataatatcagactccagagatactattttgatgaaaatgtcacgttcattgaaatgttccaagagttagaggttagtgtagaatcagagcttccacaagtactatgttcaaattgtgcaaatatgacagtaaactcttatctatttcgaaaactttgtcaatattctgactggaaatggaataaagtttttaatgaattcaataccacattagacaaatctactacaacaggaccaaacattaagactatttacttgatagtcaataagaatgaaaatgttatgttcactagtaagaaaacacttttgtcaaaaactaaaaaggatgcaatctgtaaagtaaaagatatcatgaaaagtagacagacatatatcaaagtcaaacaaagaaaatcaaatgttatatgtgaagagtgcggacaaagatttaaatcaaactgtcatctagttaagcatatgagaactcatagtaatactagatttccatgttcccattgccctaaaatatttgcatcacaagtacaattggaggagcactcggaaaggcttcattatcctaaacatatacaatgttctaaatgttctaagagatttagtacagagaaaatgctcaaatatcatgataagctttatcatgtagctgcaatatgtaaactttgctttgtgcagtttgcatcaaagaaagacttgagagcacatttagataaacatgatctaaacaagtgccctttatgtgagaaatcatttctaaacaaacatacatttaagtttcacctaaaaatatgtggtaaatctgatagtagacaattgagtttcttctgtgatatatgtaacaaaggttatgctcgtaaaaatggtttacgtacacatttaaaacggatcatggttttggtaaagtcttgtcttgtaattggtgtgaaaagaaatttgatgctattagcagattaa
Protein Sequence: MNTKIDVTLPALKFVTGDTEHICRLCFSSTESEEISIEDNIRLQRYYFDENVTFIEMFQELEVSVESELPQVLCSNCANMTVNSYLFRKLCQYSDWKWNKVFNEFNTTLDKSTTTGPNIKTIYLIVNKNENVMFTSKKTLLSKTKKDAICKVKDIMKSRQTYIKVKQRKSNVICEECGQRFKSNCHLVKHMRTHSNTRFPCSHCPKIFASQVQLEEHSERLHYPKHIQCSKCSKRFSTEKMLKYHDKLYHVAAICKLCFVQFASKKDLRAHLDKHDLNKCPLCEKSFLNKHTFKFHLKICGKSDSRQLSFFCDICNKGYARKNGLRTHLKRIMVLVKSCLVIGVKRNLMLLAD

Sequence clustering based on sequence similarity using MMseqs2