Basic Information

Insect
Samia ricini
Gene Symbol
-
Assembly
None
Location
BLXV01000037:459543-473885[+]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 10 0.00038 0.025 15.2 2.3 1 23 70 93 70 93 0.95
2 10 2.6e-05 0.0017 18.9 2.5 3 23 102 123 100 123 0.94
3 10 0.023 1.5 9.6 3.2 2 23 131 153 130 153 0.95
4 10 2.3e-05 0.0015 19.1 0.9 2 23 161 183 160 183 0.93
5 10 4.4e-05 0.0029 18.2 5.8 1 23 190 213 190 213 0.98
6 10 0.0049 0.32 11.7 6.5 1 23 219 242 219 242 0.94
7 10 8.6e-05 0.0056 17.2 0.3 3 23 251 271 249 271 0.97
8 10 0.004 0.26 12.0 1.7 2 23 279 301 278 301 0.96
9 10 7.7e-05 0.0051 17.4 3.4 2 23 308 330 307 330 0.94
10 10 2.2e-05 0.0015 19.1 3.9 1 23 340 362 340 362 0.97

Sequence Information

Coding Sequence
atggatgcagttacttcgtcagaagccatgaacatgacgacaaatgacaataaaatggaagaactaccacagatgcagcagtcgaaagagaacgtcataaagttcgtaagcgtcaacagcgaaatattaacagacgaacagaggcaaatgtacgagtcagttctctcaacgtggaaaccggttttgttccccaaacgtattaagagatacatctgcacgaggtgcaacaaggagtttaagaattaccagaacttatatttacatacgacgagggtgcactcttcggaggaatccgctgtcatctgtgacatctgcgacaaaacgtttaaaaataaacactatctttatatgcatagaatgaacaagcattattccgatatggagaaatgctattgccagttctgcctgcaggagttcaggacgcgtagggccctctatttgcatattaaaagaattcatccgactacgctaccggagatcaagtgcccggaatgtgggaaacaattccgagcgccgtacaaactcagataccacatggaaggatgtcataagaccgacaaagagaaattcaagtgtcacatctgcctaaagatttataagaaccatctcaacttgaataggcatatgcagacccaacatgctccggtgcaaagacaccgctgcgtcttttgcccgatgacgttcaaatcacgtcatcacatgaaacggcacgtgctgaacatccacccgcctctggaatcgaaggtcaactgtccggagtgcctgaaagagttcaagaacgatcagtatttgaaggagcacatgcaggtccattcctcggctgatacgaaggtgaagtgtgatttgtgcgataagttattccattcagctgtgcgtttgaagaaacataagaagattgtgcatccgacaaagcccaagttgagatgtgataagtgtgacaaagagtttgctcacgcacattatctgagacgtcataataattccgttcatatggaaatcgacgaaagcaagtatgagcatgaatgtgagcagtgcggaaagaaatttaagctgaagaagtatttaaacaatcacctgttgaggcatgaacagcagcagctgaagaggatctcgcagatggtgaagactgtcatgggagataacaagaaggaacctcagccgccgaagacgcggccggccaaggcgggcgagggcagaaatagagttcatcaaatgtga
Protein Sequence
MDAVTSSEAMNMTTNDNKMEELPQMQQSKENVIKFVSVNSEILTDEQRQMYESVLSTWKPVLFPKRIKRYICTRCNKEFKNYQNLYLHTTRVHSSEESAVICDICDKTFKNKHYLYMHRMNKHYSDMEKCYCQFCLQEFRTRRALYLHIKRIHPTTLPEIKCPECGKQFRAPYKLRYHMEGCHKTDKEKFKCHICLKIYKNHLNLNRHMQTQHAPVQRHRCVFCPMTFKSRHHMKRHVLNIHPPLESKVNCPECLKEFKNDQYLKEHMQVHSSADTKVKCDLCDKLFHSAVRLKKHKKIVHPTKPKLRCDKCDKEFAHAHYLRRHNNSVHMEIDESKYEHECEQCGKKFKLKKYLNNHLLRHEQQQLKRISQMVKTVMGDNKKEPQPPKTRPAKAGEGRNRVHQM

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01316630;
80% Identity
-