Sric009678.1
Basic Information
- Insect
- Samia ricini
- Gene Symbol
- -
- Assembly
- None
- Location
- BLXV01000030:363839-382323[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 12 0.021 1.4 9.7 3.4 1 23 293 315 293 315 0.96 2 12 5.9e-05 0.0038 17.8 0.9 2 23 323 344 322 344 0.94 3 12 0.0065 0.43 11.3 0.4 1 23 348 370 348 370 0.97 4 12 0.00036 0.023 15.3 0.9 1 23 375 398 375 398 0.98 5 12 0.00046 0.03 15.0 0.2 1 23 402 425 402 425 0.95 6 12 0.0065 0.43 11.3 0.5 2 21 443 462 443 472 0.93 7 12 3.3e-05 0.0022 18.5 1.8 3 23 477 498 477 498 0.98 8 12 0.17 11 6.9 0.7 2 23 518 540 518 540 0.97 9 12 3.2e-05 0.0021 18.6 1.3 1 23 551 573 551 573 0.97 10 12 2.1e-05 0.0014 19.1 5.1 1 23 579 601 579 601 0.99 11 12 1.5 95 3.9 5.5 1 21 607 627 607 629 0.93 12 12 4.3e-05 0.0028 18.2 0.2 1 23 635 658 635 658 0.98
Sequence Information
- Coding Sequence
- atggaaatagtaaaagtgtgtagaatatgtctcattatggacgtaaacatgtataatttgcagacacagcccttggaaacttatttcgaaccaatcatcggaaatcctttgagtgcaatggagttgccaccttttgcatgttttgaatgtgctgctctggtgaagaagtattattacttcagagatagatgtttaaaaggacaagcaatattatatgggattctgcatgcgagtggaaagattaccaaacaggaaatagaagaaataaataggccaagttttcaactggcctcaaattttacaattcatgaaataccacaagagaacataatttgccatgcttatgacgatgacaatatttttgaaataaaaaaggaacctgctgtggagaatgacaattttaagtttaatatagaagaaaaagtcaaagaagaagaagaagagtgttttgatgatcttccattactgctctcaacagatgacgatgaaccattatcaatacataaaaataataaggagaaaaaagctaaaaagaaagagaaaaggaaaggcaagagagagaagaaaaagaaatttgatgttaatgcagatgaaactgagccagttgatgaaattgaagctaaggattttataacaggtattggaacagagttacaggagatagttcccccgaaaccgaagcgaggtcggcctaggaaatcagacgtgcagccgagcagaactaaacagaaaccgcgaagaacaaccaacaccggtggagttctcgtcgacgatatagacctagaggaatacgttattgttgtgaaattgtctatcgaagaacaaatggaggagataaataagaggcaacaatcctcaaactatctgaacgcaccgtttcagtgcaaactctgttataaaggattcatagatactcacgcttggaaacatcacgtcggtaaacatgatccgagcgcaggcgaaatagaatgtccgatctgcaagtttcggtttaaaacgaaacggacattacagaagcacgccgctaaccacgagaagaaatacgcttgtaaatcatgcccttacgtttctaaaactgccactcaagccaaacagcatcagagatggcataaaggagtcacatataaatgtcagtattgtgatgaagtttccactaaatggacttcataccttagccatgttcgtatcaaacacccgtcagagtttatttgcggtgtttgcggttattcgtttgtgagcaaactcggtcttactatgcatagaactatgatgcacaaagatgttgcaaaaaaaatcgaatcggatgatgttaatgatgctggcccatactgtgaagagtgtgatgttaaattcatatccgtggaggccttcaagaggcatatggtcacgtctgttaaacatacgcagaccacacactttaataacggatgtcgagtctgcggtgagacatttaaaaattctgaagaactaagaatccaccatcgtaaagaacacgcgaggaaacgtcccaaaaattacggcaagaaaccaactaacatgacttggccggctaaatgtgaacattgttcagaagagattccgaacgcgcgcgactactggactcatttccgtcgagttcaccccgataagaattacccaatacagaagaatcacatatgtgacatctgcggcaagagtttcaggggcaacgctttcctggtatatcacaaacgtacacattcagaggagagagcgttcaagtgtcccacttgtgggaaggcgttccacaacaggacaaacctacacatgcacgagaagactcactcagacgtgaggccgtacccgtgcacggtttgcttcaaagccttcaaatgtaaaggagcactcgacagacatttcaggtgtcacacgggagtgaagccgtacgaatgcgaggtgtgcggtaaggcattcggacagtcgaacagtcggaaactgcacgtacgcacggtgcacttaaaacaaccggcgccttacatcagtcggtctcgtctccaacggaagaacaaccctcagttgcagaaggagcacgcgcaacacttcctatattag
- Protein Sequence
- MEIVKVCRICLIMDVNMYNLQTQPLETYFEPIIGNPLSAMELPPFACFECAALVKKYYYFRDRCLKGQAILYGILHASGKITKQEIEEINRPSFQLASNFTIHEIPQENIICHAYDDDNIFEIKKEPAVENDNFKFNIEEKVKEEEEECFDDLPLLLSTDDDEPLSIHKNNKEKKAKKKEKRKGKREKKKKFDVNADETEPVDEIEAKDFITGIGTELQEIVPPKPKRGRPRKSDVQPSRTKQKPRRTTNTGGVLVDDIDLEEYVIVVKLSIEEQMEEINKRQQSSNYLNAPFQCKLCYKGFIDTHAWKHHVGKHDPSAGEIECPICKFRFKTKRTLQKHAANHEKKYACKSCPYVSKTATQAKQHQRWHKGVTYKCQYCDEVSTKWTSYLSHVRIKHPSEFICGVCGYSFVSKLGLTMHRTMMHKDVAKKIESDDVNDAGPYCEECDVKFISVEAFKRHMVTSVKHTQTTHFNNGCRVCGETFKNSEELRIHHRKEHARKRPKNYGKKPTNMTWPAKCEHCSEEIPNARDYWTHFRRVHPDKNYPIQKNHICDICGKSFRGNAFLVYHKRTHSEERAFKCPTCGKAFHNRTNLHMHEKTHSDVRPYPCTVCFKAFKCKGALDRHFRCHTGVKPYECEVCGKAFGQSNSRKLHVRTVHLKQPAPYISRSRLQRKNNPQLQKEHAQHFLY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00112728;
- 90% Identity
- -
- 80% Identity
- -