Basic Information

Insect: Samia ricini
Gene Symbol: -
Assembly: None
Location: BLXV01000032:1262721-1263776[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.011 0.72 10.6 1.4 1 23 33 56 33 56 0.95

2 10 0.93 61 4.6 0.1 2 21 82 101 81 104 0.87

3 10 0.0004 0.026 15.1 0.3 2 23 126 148 125 148 0.94

4 10 0.00014 0.0091 16.6 2.2 1 23 153 176 153 176 0.95

5 10 0.00013 0.0088 16.6 0.2 2 20 182 200 181 201 0.95

6 10 0.00054 0.035 14.7 1.3 1 23 209 232 209 232 0.96

7 10 1.1e-05 0.00075 20.0 0.3 1 23 239 262 239 262 0.96

8 10 0.0016 0.1 13.3 0.7 3 23 270 290 269 290 0.96

9 10 1.8e-05 0.0012 19.4 0.4 1 23 296 318 296 318 0.99

10 10 2.5e-07 1.6e-05 25.2 2.8 1 23 324 346 324 347 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.011	0.72	10.6	1.4	1	23	33	56	33	56	0.95
2	10	0.93	61	4.6	0.1	2	21	82	101	81	104	0.87
3	10	0.0004	0.026	15.1	0.3	2	23	126	148	125	148	0.94
4	10	0.00014	0.0091	16.6	2.2	1	23	153	176	153	176	0.95
5	10	0.00013	0.0088	16.6	0.2	2	20	182	200	181	201	0.95
6	10	0.00054	0.035	14.7	1.3	1	23	209	232	209	232	0.96
7	10	1.1e-05	0.00075	20.0	0.3	1	23	239	262	239	262	0.96
8	10	0.0016	0.1	13.3	0.7	3	23	270	290	269	290	0.96
9	10	1.8e-05	0.0012	19.4	0.4	1	23	296	318	296	318	0.99
10	10	2.5e-07	1.6e-05	25.2	2.8	1	23	324	346	324	347	0.96

Sequence Information

Coding Sequence: atgccagaactgctaaggaaatacgacgtcatcaaattactcactactatggtagaaaattccacgataataccctttaggtggttcagtaatcgtttcacgtgcttctactgccgcgctcattttaatcaaccggcgatattaaaaaatcacatgtctgaagaacacagagacgctaaaatcacgacaaacctacggaatcaattgaaaacttggaaagttaacctcgatatatcgaatatcacctgcaaactttgcaacgaaagaatacctacgtatgaaaaatatttagaccatattgtcgacgctcatggcattaatataaaaaagaatttgggcaataatataccgatttacaatttggacgacgatgtacgatgtctattttgtaatgaaacgttcagttcgttcgggaatctcgtaaaccacgtccagaatgttcactgcaggtcagaccatatctgcgagatctgcggccgagggttcacttcgcgcagatgcgtcgaaaaccatttacggaacatacaccaaacaacgcagctaaagtgtcaagaatgtccaaaaattttccccaatcagagaaccttgaaatatcatatcgattgcgcgcacaggaggcaacagtttcgctgttccaaatgtccacaaactttcacgagtatttatatgaaaaggaaacacttggctatggtgcacaatgagaaatcgcatcaattcccttgcgacatatgcgcgaaggtttttacgaggaatcgtgaccttgtcacgcatagatcgagggtacatttgaaggtcaaggacgtggcttgcgagacatgtggctttagagttttcaacagggatatgctgcgaaagcatcaagcaaaacacgctggcgtgaggtcgtacgaatgtgacgtctgtagcaaaaagttcatatggaagaacaatctagaaatgcacatgaggatacacacgaacgacaggcgttacgtatgcaaacagtgcgataaggcatttgtacagaaaaccagtttgaaagttcatattaaaaagcatcatttaaaaagatgttag
Protein Sequence: MPELLRKYDVIKLLTTMVENSTIIPFRWFSNRFTCFYCRAHFNQPAILKNHMSEEHRDAKITTNLRNQLKTWKVNLDISNITCKLCNERIPTYEKYLDHIVDAHGINIKKNLGNNIPIYNLDDDVRCLFCNETFSSFGNLVNHVQNVHCRSDHICEICGRGFTSRRCVENHLRNIHQTTQLKCQECPKIFPNQRTLKYHIDCAHRRQQFRCSKCPQTFTSIYMKRKHLAMVHNEKSHQFPCDICAKVFTRNRDLVTHRSRVHLKVKDVACETCGFRVFNRDMLRKHQAKHAGVRSYECDVCSKKFIWKNNLEMHMRIHTNDRRYVCKQCDKAFVQKTSLKVHIKKHHLKRC

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01316652;
90% Identity: -
80% Identity: -