Sric010400.1
Basic Information
- Insect
- Samia ricini
- Gene Symbol
- topi
- Assembly
- None
- Location
- BLXV01000001:28154509-28157965[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 0.0076 0.5 11.1 1.1 1 20 138 157 138 166 0.92 2 9 0.0015 0.097 13.4 5.5 1 23 179 201 179 201 0.98 3 9 8e-06 0.00052 20.5 0.8 5 23 210 228 208 228 0.97 4 9 1e-05 0.00068 20.1 2.1 1 23 234 256 234 256 0.97 5 9 3.8e-05 0.0025 18.3 4.4 1 23 261 283 261 283 0.97 6 9 0.00021 0.014 16.0 0.7 1 23 289 311 289 311 0.98 7 9 0.00012 0.0081 16.8 2.0 2 23 318 339 317 339 0.97 8 9 2.1e-07 1.4e-05 25.5 1.1 1 23 345 367 345 367 0.99 9 9 1.8e-05 0.0012 19.4 0.9 1 23 373 396 373 396 0.98
Sequence Information
- Coding Sequence
- atgaaccacgttcaatcaatgaacatttgtagaatttgtttacagaaaatggatgaattaacggaattattttgtgaaaaagacaaatccagagatatactcaataaaattaacttatgtttccaaattgtgatgaaacctgaaaaaaatattccatctgtaatttgtgaaacttgtgttacagaactagataaagttaatgaatttagaatcatgtgtatgacaatcaatgagcgttttaaggcattacatcaagaattatcaggaattaaaaaattagaaacaacacaccaaacaaatattactcaggttaatgattgtcatgaatattttgatgaaactaatcatgtaatagacgaagtagatgagcaagtgatttctagtggtaaagatgtttttattaaaggaacttttgtatgtactacttgtaataaagttctgaaatcgatggtttctctaatgaaacacaatgtcaacatgcatgaaagaaggaagcatataggtaaagttactggttttggatctgaacgccgctatcattgtaactcatgtgaatattccactccacacagtcagactttaactaatcatatgagaaggcataatggtgagagaccatattcctgtgaatgtggaaagagttttacgcaatcatctagtctagcagcacataaaaaaacccatagctctgtaactttctttacatgttcagtgtgtggaaaacaatttaaacatgctttcacactaaaaaatcatgaaatagtccatgaaaatggacattttaattgtacaatttgtcaaaagacgttgaaatcaaaaagatcactacgagctcacatgcatagacactgcaatatatataattacaactgtcaaaattgtggagacacttttgttacatctgcagaattattgaatcataagaaaaaacatgagttagataaaaatatagaatgtcatttatgtggttacaaaacatatactaaaaagaatttagttattcatcttaaaaggcacgttggcaataaagaatacaagtgtgatatttgtcaaatgcctttctacagtcagagtgaattacgacgtcatcggcgtgtgcatacacaagagaaacctttctcatgcccgacttgtgcccagagatttactcagagtacaagtgttaataaacacatgcaaactgtacacggggtaaacttcaaatggggtgaagttaaaagagaaagaaaaatttcgaagaaacagacttaa
- Protein Sequence
- MNHVQSMNICRICLQKMDELTELFCEKDKSRDILNKINLCFQIVMKPEKNIPSVICETCVTELDKVNEFRIMCMTINERFKALHQELSGIKKLETTHQTNITQVNDCHEYFDETNHVIDEVDEQVISSGKDVFIKGTFVCTTCNKVLKSMVSLMKHNVNMHERRKHIGKVTGFGSERRYHCNSCEYSTPHSQTLTNHMRRHNGERPYSCECGKSFTQSSSLAAHKKTHSSVTFFTCSVCGKQFKHAFTLKNHEIVHENGHFNCTICQKTLKSKRSLRAHMHRHCNIYNYNCQNCGDTFVTSAELLNHKKKHELDKNIECHLCGYKTYTKKNLVIHLKRHVGNKEYKCDICQMPFYSQSELRRHRRVHTQEKPFSCPTCAQRFTQSTSVNKHMQTVHGVNFKWGEVKRERKISKKQT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -