Basic Information

Transcription Factor Domain

TF Family: Runt
Domain: Runt domain
PFAM: PF00853
TF Group: Beta-Scaffold Factors
Description: The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 0.21 2.3e+03 -0.1 0.0 11 31 18 38 13 39 0.82

2 2 9.5e-20 9.9e-16 59.3 0.2 92 129 39 76 36 76 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	0.21	2.3e+03	-0.1	0.0	11	31	18	38	13	39	0.82
2	2	9.5e-20	9.9e-16	59.3	0.2	92	129	39	76	36	76	0.97

Coding Sequence: ATGTTCTGGGggcgaccaaaatcggacccaggagaagCCTGGCCtccagatactgtaaagaagacgaggaaacctcaattcatcttctttacacctgccccgcactggaggagaagaggtaaAAGCTTCACCCTGACGATCATCGTATCGACATCGCCTCCCCAGATAGCGACTTATAACAAAGCGATCAAAGTCACAGTGGACGGACCTCGGGAGCCAAGATCGAAGACGCGCCAGCAAGGGTTTCACCATTTCCCTTTCGGACCCAGGCCTTTTGCACCTGATCCACTTACGGGGAGTCTCCCTTTTAAATTGAGTGGTGAGTAA
Protein Sequence: MFWGRPKSDPGEAWPPDTVKKTRKPQFIFFTPAPHWRRRGKSFTLTIIVSTSPPQIATYNKAIKVTVDGPREPRSKTRQQGFHHFPFGPRPFAPDPLTGSLPFKLSGE

Sequence clustering based on sequence similarity using MMseqs2