Basic Information

Insect: Rhynchophorus ferrugineus
Gene Symbol: -
Assembly: GCA_014462685.1
Location: JAACXV010000039.1:937087-937989[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 7.3e-08 5.7e-06 26.8 1.5 2 23 20 41 19 41 0.97

2 10 6.3e-05 0.0049 17.6 3.5 1 23 47 70 47 70 0.97

3 10 0.011 0.89 10.5 4.0 1 23 76 98 76 98 0.98

4 10 0.066 5.2 8.1 2.1 2 23 105 127 104 127 0.93

5 10 5.9e-06 0.00046 20.8 0.3 3 23 134 154 132 154 0.96

6 10 0.11 8.8 7.3 3.6 3 23 165 183 164 183 0.92

7 10 8.2e-06 0.00064 20.4 0.0 2 23 190 211 189 211 0.96

8 10 1.5e-07 1.2e-05 25.8 2.5 1 23 217 239 217 239 0.99

9 10 1.5e-08 1.2e-06 28.9 0.8 1 23 245 267 245 267 0.99

10 10 0.00059 0.046 14.5 0.6 1 23 273 296 273 296 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	7.3e-08	5.7e-06	26.8	1.5	2	23	20	41	19	41	0.97
2	10	6.3e-05	0.0049	17.6	3.5	1	23	47	70	47	70	0.97
3	10	0.011	0.89	10.5	4.0	1	23	76	98	76	98	0.98
4	10	0.066	5.2	8.1	2.1	2	23	105	127	104	127	0.93
5	10	5.9e-06	0.00046	20.8	0.3	3	23	134	154	132	154	0.96
6	10	0.11	8.8	7.3	3.6	3	23	165	183	164	183	0.92
7	10	8.2e-06	0.00064	20.4	0.0	2	23	190	211	189	211	0.96
8	10	1.5e-07	1.2e-05	25.8	2.5	1	23	217	239	217	239	0.99
9	10	1.5e-08	1.2e-06	28.9	0.8	1	23	245	267	245	267	0.99
10	10	0.00059	0.046	14.5	0.6	1	23	273	296	273	296	0.96

Sequence Information

Coding Sequence: aTGGCCATAGTTAAAGGGGAACCGGTAGATTACTCGACGGTGCCTAAATCGGCCATTCAATGTCCTCAATGCGGAAAATCGTTTAAGAAACGCTACTTTTTAAGACGGCACATGATCAGTCACACGTCCGAGCGACCATTTAAGTGTCCCAAATGTtcgaaaacctttaaaactgaGTACAGTCAAACGCAGCATACGCTGAAAATGCACGATACAAGAAAAACGTTTCAGTGCGACAGTTGTCAGCAAACGTTCATGTCTCAGCACAGACTCTATATCCATACATTGAGGCATACCAACGAGTACGTGGTGAAATGCGAGTTTTGCGGACAGGGGTTCTTCGACAAATATCAGCACAGATTACACTTGGAGTCAAAGCACAGTGAAAATCAAAGTATTTGCGTGGTATGTGGTAAAAGCATGTCCACGAAATACAACCTGAAAATCCACATGAACATACATCAAAAACGAGAGGAAAAAGCACCCCAAGCTTGTCCGCATTGCCAGAAAGAATTCAAGTTTCTCAAAGCTCACATCCGTCGAGCCCACACCGACAAACCGACGCTAGTTTGTGAACTATGCGGAAAGAGATTTGCTGGAAAGGACGGCTTGAAAATCCACCTGATGATCCATCAAGGTATCAAACCCTACCAATGTCAGTTTTGTGAAAAGATGTTCACactaaaagataatttaaaacagCACATCCGGACACATACAGGTGAACGTCCTTATCAGTGCACGGAATGTGGAAAGCGTTTCTCCCAGAGATCTCCGCTGAAAATCCACTTGAGGATACACTCAGGAGAGAAACCTTACGACTGTGAATTGTGTGACGCAAAGTTTTCGTCGAAAATGGTTCTAAATACTCACAAAAAGAGTGTTCACAAACTAGTTTCATAA
Protein Sequence: MAIVKGEPVDYSTVPKSAIQCPQCGKSFKKRYFLRRHMISHTSERPFKCPKCSKTFKTEYSQTQHTLKMHDTRKTFQCDSCQQTFMSQHRLYIHTLRHTNEYVVKCEFCGQGFFDKYQHRLHLESKHSENQSICVVCGKSMSTKYNLKIHMNIHQKREEKAPQACPHCQKEFKFLKAHIRRAHTDKPTLVCELCGKRFAGKDGLKIHLMIHQGIKPYQCQFCEKMFTLKDNLKQHIRTHTGERPYQCTECGKRFSQRSPLKIHLRIHSGEKPYDCELCDAKFSSKMVLNTHKKSVHKLVS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -