Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0027 0.19 11.7 1.2 2 23 82 102 81 102 0.97

2 5 0.00013 0.0094 15.8 1.6 1 23 106 128 106 128 0.97

3 5 4.4e-05 0.0031 17.3 0.7 1 19 135 153 135 157 0.97

4 5 0.0017 0.12 12.3 1.2 2 21 163 182 162 183 0.94

5 5 1.7 1.2e+02 2.8 1.4 2 15 208 221 207 224 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0027	0.19	11.7	1.2	2	23	82	102	81	102	0.97
2	5	0.00013	0.0094	15.8	1.6	1	23	106	128	106	128	0.97
3	5	4.4e-05	0.0031	17.3	0.7	1	19	135	153	135	157	0.97
4	5	0.0017	0.12	12.3	1.2	2	21	163	182	162	183	0.94
5	5	1.7	1.2e+02	2.8	1.4	2	15	208	221	207	224	0.84

Coding Sequence: ATGGGCATTAAAGATGATtttgtatcaaatattataagaaatgaAATTCATTACCgcaagaaacaaaaaaaaactaaaggtgcTACTAGTACTACATACTCTTCAAAAAATGCATTGGATGatgaagaatttaaatttttATTGAAAAGAATTGcagaaaaattgaataaaaagaaaaagaaatcaaataaaatacaattaaaaattggaaaagCGTCCAATTATACTAAAGATGATGAAGTAAAATGCAACACATGTAAACAGTTATTCTCTAAGACCTATTTGGTTATTCATATGCAATCTCATAAGGctttatataattgtgataTTTGTAACAAGAATTTCTCTTACCtttcaatattcaatagaCACAAAGCAACTCACAAAAGGGATGTGGTAATCTAtgaatgtaaattatgtaatataacatttaggAATCCTAATGATTTATCCAAACATGATATATTTCATGAAGAAGAAAgtataaaatgtctattttgttttaaaacatttaagcaatttaatgattttctgaACCACATTAATATGTACTCATTTGACAAACCCACTCAAAGTTTAACTaatcgtataaaaatacacagtGAAGGCATACACTGCTCATCATGTTGTACTTGTAAAATGAGTTTTGCAAAACGTGATactgtcataaaatatattgtatga
Protein Sequence: MGIKDDFVSNIIRNEIHYRKKQKKTKGATSTTYSSKNALDDEEFKFLLKRIAEKLNKKKKKSNKIQLKIGKASNYTKDDEVKCNTCKQLFSKTYLVIHMQSHKALYNCDICNKNFSYLSIFNRHKATHKRDVVIYECKLCNITFRNPNDLSKHDIFHEEESIKCLFCFKTFKQFNDFLNHINMYSFDKPTQSLTNRIKIHSEGIHCSSCCTCKMSFAKRDTVIKYIV

Sequence clustering based on sequence similarity using MMseqs2