Rmeg026406.1
Basic Information
- Insect
- Rhimphoctona megacephalus
- Gene Symbol
- -
- Assembly
- GCA_963989365.1
- Location
- OZ022423.1:9109459-9109941[-]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.0003 1.2 9.6 0.1 13 34 51 71 51 73 0.82 2 2 1.6e-05 0.062 13.7 0.6 1 33 110 149 110 152 0.89
Sequence Information
- Coding Sequence
- atgttgtttttatcTTGTTTGCTTGCAGAACGTACGTACAGCGCTTCGAATTGGACGGTCCCAACGTTGCCCTCGACCTCGCGCGATTATTTCTCAAGACGTCTACGCTCGACGACTCAAAGCGCCGAAGCCATATTGGGCGAAGGCTGTCGCAGGATAGGCTCCAAAAAATATCTTTGCCGTGATTGCGGTAGCACTTTTGCCCTGAAAGCCTCCCTCGTACGACATCAGTATCTCGAGTGTACAAAAACTCCACCAACGCCTAAACGTCGAAGCGAGCCAAGATCAGGCAGCGAAGTTAAACACGaaggaaataaaaaacacgATTGTGTCAATTGTGGGCGTACTTACGCCTTTTACACGTCACTCTGGCGACATCAACATTACGAGTGCGGAATGGAACCGAAATTTGATTGTAACATTTGTCAAATCAAATTTGCTCAGAAGAGCAATCTCGATCGTCACATGCGCAATCGACACTGA
- Protein Sequence
- MLFLSCLLAERTYSASNWTVPTLPSTSRDYFSRRLRSTTQSAEAILGEGCRRIGSKKYLCRDCGSTFALKASLVRHQYLECTKTPPTPKRRSEPRSGSEVKHEGNKKHDCVNCGRTYAFYTSLWRHQHYECGMEPKFDCNICQIKFAQKSNLDRHMRNRH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01129661;
- 90% Identity
- iTF_00439813;
- 80% Identity
- iTF_01299607;