Basic Information

Insect: Rhamnusium bicolor
Gene Symbol: -
Assembly: GCA_029963845.1
Location: JANEYF010004465.1:84359-85333[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.13 27 7.5 2.2 1 23 19 41 19 41 0.97

2 10 0.0022 0.45 13.1 2.8 1 23 50 72 50 72 0.99

3 10 0.64 1.3e+02 5.3 1.1 1 23 81 103 81 103 0.93

4 10 0.012 2.4 10.8 5.8 1 23 112 134 112 134 0.99

5 10 6.2e-05 0.013 18.0 0.4 1 23 143 165 143 165 0.97

6 10 0.0095 2 11.1 0.1 1 23 174 196 174 196 0.99

7 10 0.0031 0.63 12.6 1.9 1 23 202 224 202 224 0.97

8 10 0.00019 0.039 16.4 1.5 1 23 233 255 233 255 0.98

9 10 0.011 2.4 10.8 3.5 1 23 264 286 264 286 0.92

10 10 0.12 25 7.6 1.2 1 23 295 317 295 317 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.13	27	7.5	2.2	1	23	19	41	19	41	0.97
2	10	0.0022	0.45	13.1	2.8	1	23	50	72	50	72	0.99
3	10	0.64	1.3e+02	5.3	1.1	1	23	81	103	81	103	0.93
4	10	0.012	2.4	10.8	5.8	1	23	112	134	112	134	0.99
5	10	6.2e-05	0.013	18.0	0.4	1	23	143	165	143	165	0.97
6	10	0.0095	2	11.1	0.1	1	23	174	196	174	196	0.99
7	10	0.0031	0.63	12.6	1.9	1	23	202	224	202	224	0.97
8	10	0.00019	0.039	16.4	1.5	1	23	233	255	233	255	0.98
9	10	0.011	2.4	10.8	3.5	1	23	264	286	264	286	0.92
10	10	0.12	25	7.6	1.2	1	23	295	317	295	317	0.94

Sequence Information

Coding Sequence: ATGAAACTCGAAGGAAACGAGGAGACAGCATTAATCCAACCGACATCACCTTCATTTACTTGTACGCAATGCTCGTACAAAACAAGTGTACTGCGTAGATTGAAGGCGCACTCTCTTAAACACAAGGATCGTTTGACCATGACCATGTTCAAATGTTACAACTGCTCGTTTGAGACGAAACGTAAAACGGCACTTAAAATGCACCTTCTAACCCACAGAGATCCCTCGGAAGTGAAGATGTTCAAGTGTCAGTTGTGTTCTTTTGAAACGATTTGGATAGACTCTCTGAAGAAACACCAGACGAGACATGAATCTTTAAATAAGGGAATTATGTACAAGTGCAAGTTCTGCAGTTATGAGACGAATAAAAAGCATTTACTCAAGTCGCATTTACTACGGCACAAAAGCCCATCGGAAATAACAATGTACAAGTGTGATTGGTGCCCGTACGAGACAAAAAGAAAGGGCAATCTTCGAGAGCATGTAGTGAAACATAAGGAACCTTCCGAGATAACTATGTATAAGTGCGGCATTTGCCCATACGCGACGAAATGGCAGAGCGGGATTAAGGCGCATCGAATGACACATAGAAAACATCCCAGTCACAAGTGTGATAAATGCGATTTTGAAGCAGACAAAAGAAGTGACCTGCTTCGGCACTTACAAAACCATCCAAAGGACGTTTCGTTGAAAATTTACTCCTGCGAACTGTGTGCGTACAGTACTCAATACAAGACGAATCTAAACAAGCATATGAACATGCACAAGGATTCTTCGGAGGCTCCAACGTTTCAATGTGACCAGTGCTCATATGTGACGAAGCATAGGACGGCTCTTAAGAACCATTCTTTTCTTCATATGGACAAGTCGAAGCTTACATTGTTCAAATGTGATTTATGTTCGTACGAGACTTTTAGAAGGAGCATCTTGTTGAAGCACGTCGAAAGGCATAATGTAGCTAAAGAAGAGCACTGA
Protein Sequence: MKLEGNEETALIQPTSPSFTCTQCSYKTSVLRRLKAHSLKHKDRLTMTMFKCYNCSFETKRKTALKMHLLTHRDPSEVKMFKCQLCSFETIWIDSLKKHQTRHESLNKGIMYKCKFCSYETNKKHLLKSHLLRHKSPSEITMYKCDWCPYETKRKGNLREHVVKHKEPSEITMYKCGICPYATKWQSGIKAHRMTHRKHPSHKCDKCDFEADKRSDLLRHLQNHPKDVSLKIYSCELCAYSTQYKTNLNKHMNMHKDSSEAPTFQCDQCSYVTKHRTALKNHSFLHMDKSKLTLFKCDLCSYETFRRSILLKHVERHNVAKEEH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -