Basic Information

Insect: Rhagonycha fulva
Gene Symbol: -
Assembly: GCA_905340355.1
Location: HG996554.1:6503309-6504304[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00012 0.0035 18.5 2.0 1 23 68 90 68 90 0.97

2 9 0.0023 0.067 14.5 4.7 1 23 96 118 96 118 0.99

3 9 0.00011 0.0032 18.7 2.7 1 23 124 146 124 146 0.98

4 9 0.00026 0.0075 17.5 6.6 1 23 152 174 152 174 0.98

5 9 0.0023 0.067 14.5 7.8 1 23 180 202 180 202 0.96

6 9 0.00025 0.0073 17.5 1.5 1 23 208 230 208 230 0.97

7 9 0.00062 0.018 16.3 1.4 1 23 236 258 236 258 0.98

8 9 0.00023 0.0068 17.7 3.4 1 23 264 286 264 286 0.98

9 9 0.026 0.75 11.2 3.0 1 23 292 314 292 314 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00012	0.0035	18.5	2.0	1	23	68	90	68	90	0.97
2	9	0.0023	0.067	14.5	4.7	1	23	96	118	96	118	0.99
3	9	0.00011	0.0032	18.7	2.7	1	23	124	146	124	146	0.98
4	9	0.00026	0.0075	17.5	6.6	1	23	152	174	152	174	0.98
5	9	0.0023	0.067	14.5	7.8	1	23	180	202	180	202	0.96
6	9	0.00025	0.0073	17.5	1.5	1	23	208	230	208	230	0.97
7	9	0.00062	0.018	16.3	1.4	1	23	236	258	236	258	0.98
8	9	0.00023	0.0068	17.7	3.4	1	23	264	286	264	286	0.98
9	9	0.026	0.75	11.2	3.0	1	23	292	314	292	314	0.96

Sequence Information

Coding Sequence: ATGGCTCAAGTACTGCCCTCAGAAGAGTTACAAATGGTAAAAAATATTGGTAGTGAACTTTTGGAAACCACCAGTTATGAAATTAAAATAGAAGAGTTGGAAGATGTGAAACCGGATATGGAAGATTTGCATCATTCAATCGACATTAAGGAAGAGAGCGATGCTGTGCAACAGGATAAGCTTGCCTACCAAGCTAAGCCGTTTGCTTGCGATATTTGTAACTATAAATGTGCATATAAATCAAATCTAAAAGTTCATTCAAGGATTCACACCGGAGAAAAACCATTTACTTGTAAAACCTGTGACTTTAAATGTGCACTAAAATTTAATTTAGCAAGGCACTTGAAAACTCACACTGGCGAGAAACCGTTCAGTTGTGATCTGTGCGATTATAAATGTTCCCAAAAGGAAAGTCTGAAAGTACATTTAATGAGTCATTCCAGCGATAAACCGTTTTCTTGTAAAATTTGTGACTATAAATGTGCACAAAGGTGTAACTTACAGAGGCACTTGAAAATGCATACCGGCGAGAAGCCTCACTGTTGTAAATTTTGTGACTACAAATGTGCAGATAAATCGAATTTAAAAGTTCATTTAAAAATTCACACCGGGGAAAAACCTTTTGCTTGTGAAATTTGCGACTTTAAATGTGCGGTTAAATCAAGTTTAAAACTGCATTTAAGAAGTCATACGGGTGAAAAACCATTCCCATGTAATATTTGTAAATTTAGAGGCGCACAAAAATCCGATTTAAAACAGCATTTTAAAACTCACACCGGGGAAAAACCGTTTTCGTGTGATATTTGCGGTTATAAATGTGCACACACTTCAAATATAAAAGTACATATAAAAACTCACACCGGGGAGAAGCCTTTTTCATGTGAAATTTGCCACTATAAAAGTTTATATAAAGCAGGGTTAAAAAGGCATTTAAAGACCCACACGGGTTAA
Protein Sequence: MAQVLPSEELQMVKNIGSELLETTSYEIKIEELEDVKPDMEDLHHSIDIKEESDAVQQDKLAYQAKPFACDICNYKCAYKSNLKVHSRIHTGEKPFTCKTCDFKCALKFNLARHLKTHTGEKPFSCDLCDYKCSQKESLKVHLMSHSSDKPFSCKICDYKCAQRCNLQRHLKMHTGEKPHCCKFCDYKCADKSNLKVHLKIHTGEKPFACEICDFKCAVKSSLKLHLRSHTGEKPFPCNICKFRGAQKSDLKQHFKTHTGEKPFSCDICGYKCAHTSNIKVHIKTHTGEKPFSCEICHYKSLYKAGLKRHLKTHTG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -