Rluc026401.1
Basic Information
- Insect
- Reticulitermes lucifugus
- Gene Symbol
- -
- Assembly
- GCA_026260175.1
- Location
- JAKCWW010017498.1:5525-12122[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 13 1.5e-06 0.00014 22.8 2.9 1 23 166 188 166 188 0.98 2 13 8.9e-06 0.00088 20.3 1.9 1 23 194 216 194 216 0.97 3 13 0.00058 0.058 14.6 1.7 1 23 222 244 222 244 0.97 4 13 8e-06 0.0008 20.4 2.0 1 23 250 272 250 272 0.98 5 13 7.8e-06 0.00078 20.5 0.8 1 23 306 328 306 328 0.98 6 13 4.6e-06 0.00046 21.2 0.6 1 23 334 356 334 356 0.98 7 13 0.00043 0.043 15.0 1.9 1 23 362 384 362 384 0.98 8 13 1.4e-06 0.00014 22.8 2.6 1 23 390 412 390 412 0.97 9 13 4.2e-07 4.2e-05 24.4 0.6 1 23 418 440 418 440 0.98 10 13 4.5e-06 0.00045 21.2 2.1 1 23 446 468 446 468 0.98 11 13 2.5e-06 0.00025 22.0 1.6 1 23 474 496 474 496 0.97 12 13 6.6e-05 0.0066 17.5 2.1 1 23 502 524 502 524 0.97 13 13 0.00012 0.012 16.8 6.0 1 23 530 552 530 552 0.97
Sequence Information
- Coding Sequence
- ATGATGTGTGCTGAACGAAATTTAAGGTTACGAAAGACTTTGCACTCCCTTGCAACAAAGGTGCCAGTAGTTATACTACAGAGAGTTGAAGATAGATTTCCTGGTCTGAGAGAAAGGCTGAACCGTATGGCTGTACTGAAAAGTGAACCTCCTTCATGTGCTGAGTTATGTCTGACGTCATCTGATGATAGAAATCAGGTTGTTGGTATAAAAGTTGAAGGGATCGCAGATATAGAAGTGGAAGAGTGTGGAGAGCCATCATCATCTCCACAACCTCCAAACTGTGTGGATTCACTGAGAAGTGGCCCTGTTTCATGTAGTGAGACATGCCTGAGGTCGTCTGATGATAGAAATGAGATCATAGATATAAAAGTTGAAGAGGCAACTGATATAAAGGAGGAAGAACATCCAGAGCCAATACCATTTCAAACGATAAAGACAGAACCTGAGagcagactgaatgaacagacttatgcacgtagtcgagcgcatcccttttcctgtgatgtatgtaacaagacatttggtcaacagagtcatctgatgacacataagcggatacatagtggagagctgcccttttgctgtgatgtatgtaacaaggaatttggtcaaaagagtgatctattgacacatatgcagttacatggccgagagcgccccttttgctgtgatgtatgtaacaaggcatttggtctacagaatcttctgatgacacataagcggatacatattggagagcgacccttttcctgtgatgtatgtaacaaggcatttggtcaacagaatcatctgatgacacataagcggatacatagtggagagcggcccttttcctgtgatgtatgtaacaagnnnnnnnnnnnnnnnnnnnnnntgatgacacataagcggatacatagtggagagcggcccttttcctgtgatgtatgtaacaaggagtttggtgaaaagagtaatctgatgaaacataagcaggtacatagtggagagcggcccttttcctgtgatgtatgtaacaaggcatttggtgaacagagtactctgatgagacataagcggatacacagtggagagcaccccttttcctgtgatgtatgtaacaaggcatttggtcaacagtgtgatatgttgaaacataagcagatacacagtggagagcggcccttttgctgtgatgtatgtaacaaggcatttggtcaacagagtaatctgatgaaacataagcggatacatagtggagagcggcccttttcctgtgatgtatgtaataaggcgtttggtcaacagagtaatctgatgaatcataagcggatacatagaggagagcggcccttttcctgtgatgtatgtaataagacgtttcgtgaaaagagtaatatgatgaaacataagcaggtacatagtggagagcggcccttttgctgtgatgtgtgtaagaaggcgtttggtcgaaagagtgatctagtgacacatatgcagatacatagtggattgcggcccttttgttgtgatgtatgtaacaaggcatttggtcaaaagggtaatatgatgaaacataagcaggtacatagtggagagcggcccttttgctgtgatttgtgtaataaggcatttggtcacaagagtaagctgatgaaacataagcgtgttcatagtggggagCCAACGTTTAGTCTGACCACTGTAACATTAAAATAA
- Protein Sequence
- MMCAERNLRLRKTLHSLATKVPVVILQRVEDRFPGLRERLNRMAVLKSEPPSCAELCLTSSDDRNQVVGIKVEGIADIEVEECGEPSSSPQPPNCVDSLRSGPVSCSETCLRSSDDRNEIIDIKVEEATDIKEEEHPEPIPFQTIKTEPESRLNEQTYARSRAHPFSCDVCNKTFGQQSHLMTHKRIHSGELPFCCDVCNKEFGQKSDLLTHMQLHGRERPFCCDVCNKAFGLQNLLMTHKRIHIGERPFSCDVCNKAFGQQNHLMTHKRIHSGERPFSCDVCNKXXXXXXXXMTHKRIHSGERPFSCDVCNKEFGEKSNLMKHKQVHSGERPFSCDVCNKAFGEQSTLMRHKRIHSGEHPFSCDVCNKAFGQQCDMLKHKQIHSGERPFCCDVCNKAFGQQSNLMKHKRIHSGERPFSCDVCNKAFGQQSNLMNHKRIHRGERPFSCDVCNKTFREKSNMMKHKQVHSGERPFCCDVCKKAFGRKSDLVTHMQIHSGLRPFCCDVCNKAFGQKGNMMKHKQVHSGERPFCCDLCNKAFGHKSKLMKHKRVHSGEPTFSLTTVTLK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -