Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0025 6.4 7.8 0.4 15 41 15 38 9 40 0.84

2 9 3.7e-05 0.095 13.6 0.5 19 41 47 66 42 69 0.91

3 9 0.044 1.1e+02 3.8 0.2 18 29 74 85 67 96 0.82

4 9 0.0097 25 5.9 0.6 18 40 102 121 88 124 0.79

5 9 0.0079 20 6.2 0.2 18 39 130 148 122 156 0.81

6 9 0.011 29 5.7 3.1 14 41 154 178 143 180 0.79

7 9 0.0053 14 6.7 5.4 5 41 174 206 172 208 0.82

8 9 0.0002 0.51 11.3 1.5 18 40 214 233 206 236 0.89

9 9 0.002 5.2 8.1 0.7 18 41 242 262 234 264 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0025	6.4	7.8	0.4	15	41	15	38	9	40	0.84
2	9	3.7e-05	0.095	13.6	0.5	19	41	47	66	42	69	0.91
3	9	0.044	1.1e+02	3.8	0.2	18	29	74	85	67	96	0.82
4	9	0.0097	25	5.9	0.6	18	40	102	121	88	124	0.79
5	9	0.0079	20	6.2	0.2	18	39	130	148	122	156	0.81
6	9	0.011	29	5.7	3.1	14	41	154	178	143	180	0.79
7	9	0.0053	14	6.7	5.4	5	41	174	206	172	208	0.82
8	9	0.0002	0.51	11.3	1.5	18	40	214	233	206	236	0.89
9	9	0.002	5.2	8.1	0.7	18	41	242	262	234	264	0.84

Coding Sequence: ATGGAACTATCACAAGAGCAGTTAGGCAATCACTCAACCGAGAAACCGTTTCATTGCCCACTTTGCGATAAGACCTTTTCAAGGAACGCAGGTATGAAGGTGCACTTAAGGTCCCATACCGGGGAGAAGCCGTACCCCTGCAACGTCTGCGAAAAGACATTCGCGTCCACCCACGGCCTCAAATACCACTTAAGCTCCCACTCCGGCGAAAAGCCATATTCTTGTACATTGTGCGACAAGACGTTCGCCAGGGGCGATTATCTGAAGTTGCACATGTCTATTCATACCGGCGAAAAGCCGTTCCCTTGCACGATTTGCGACAAAACGTTTTCTTCGAGGATGCGACTAAAAGTGCACTTAAGGAACCATGCCGGGGAAGAGCCGTTCTCTTGCACAATTTGCGACAAAACTTTCTCTAGCGATGGGGCCTTGAAGAGCCACTTAACGATTCACGCCGGTGAAGAACGGTTCCCTTGCACTCTTTGCGAGAAGAAGTTCTCCACGAATAAGTACCTGAAGAATCACCTAAAGAGGCATTCCGGGGAAAAGCCGTTCTCGTGCACGATTTGCAATAAGCTGTTCTCTGCCAATAGGAACTTGAAGAGTCACCTACGGAGTCACGCTGGGGAAAAACCGTTTGCGTGCATTATTTGCAATAAGAAATTTGTTGCGAAGAGGAACTTGAGGAGTCACCTGCGACTGCATGCTAGCGATGAGTTGCTTtcgtgtacaatttgcgaTAAAAAATTTACGAGGAATGACAATTTAAAGAAGCACTTTGAACGTCATACTGGAAACAAGGATAAATga
Protein Sequence: MELSQEQLGNHSTEKPFHCPLCDKTFSRNAGMKVHLRSHTGEKPYPCNVCEKTFASTHGLKYHLSSHSGEKPYSCTLCDKTFARGDYLKLHMSIHTGEKPFPCTICDKTFSSRMRLKVHLRNHAGEEPFSCTICDKTFSSDGALKSHLTIHAGEERFPCTLCEKKFSTNKYLKNHLKRHSGEKPFSCTICNKLFSANRNLKSHLRSHAGEKPFACIICNKKFVAKRNLRSHLRLHASDELLSCTICDKKFTRNDNLKKHFERHTGNKDK

Sequence clustering based on sequence similarity using MMseqs2