Ppup008953.1
Basic Information
- Insect
- Pteromalus puparum
- Gene Symbol
- MYRF
- Assembly
- GCA_012977825.2
- Location
- Scaffold:641806-713300[+]
Transcription Factor Domain
- TF Family
- NDT80_PhoG
- Domain
- NDT80_PhoG domain
- PFAM
- PF05224
- TF Group
- Unclassified Structure
- Description
- This family includes the DNA-binding region of NDT80 [2] as well as PhoG and its homologues. The family contains Swiss:Q05534 or VIB-1. VIB-1 is thought to be a regulator of conidiation in Neurospora crassa and shares a region of similarity to PHOG, a possible phosphate nonrepressible acid phosphatase in Aspergillus nidulans. It has been found that vib-1 is not the structural gene for nonrepressible acid phosphatase, but rather may regulate nonrepressible acid phosphatase activity [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.8e-25 8.4e-21 75.0 0.1 109 179 5 77 2 78 0.93
Sequence Information
- Coding Sequence
- GTTGACGTTGGCGATGAGCATGTGACAAAGGTGACAGTCGGACGTTTGCACTTTAGTGAAACCACGAGCAACAATATGAGAAAAAAGGGTAAACCTAATCCAGATCAAAGGTATTTTTATTTGGTCGTCGGGCTTCATGCTCATACATCTGATCAAACCAACTATCAAGTGGCCGCACACGCTTCTGAGAGGATAATTGTTAGGGCAAGTAATCCGGGGCAATTTGAATCGGAAGGTAGCTCAGGTGGCTCTGAAAGTAATTGGCAAAGGGGAGCAGCACCAGATAGCATCTATCATATAGGTCGAGTTGGTATCAATACTGATCGACCTGATGAAACTTTCGTTGTACACGGTAACGTAAAG
- Protein Sequence
- VDVGDEHVTKVTVGRLHFSETTSNNMRKKGKPNPDQRYFYLVVGLHAHTSDQTNYQVAAHASERIIVRASNPGQFESEGSSGGSESNWQRGAAPDSIYHIGRVGINTDRPDETFVVHGNVK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00866711;
- 90% Identity
- -
- 80% Identity
- -