Pden019107.1
Basic Information
- Insect
- Pseudomyrmex dendroicus
- Gene Symbol
- HSFX4_1
- Assembly
- GCA_014825645.1
- Location
- QVNZ01007728.1:14095-15425[+]
Transcription Factor Domain
- TF Family
- HSF
- Domain
- HSF_DNA-bind domain
- PFAM
- PF00447
- TF Group
- Helix-turn-helix
- Description
- Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.3e-27 5.6e-23 81.9 0.1 1 100 12 114 12 114 0.90
Sequence Information
- Coding Sequence
- ATGTTCGATGACTGCGTATTGCAGTCGATGCGGTTTCCGCAGAAGCTCTGGCGTATCGTGAACGAGTGCAAGACCGGAGCGATTCGATGGGGCGCTAACGGCGATACTATCCTGCTGGACTACAAAAAGTTCCAGACGGAGTATTTAGACGCTCATCGACCGATCTTCAAGACCAACAACATCACCAGCTTCATCAGGCAGCTTAATCTCTACGGATTCCGTAAGGTGACATCGCACAACCGTGACCCCATGTGTAACTTCTGCAATCCGCACGTGCACGAATTCATGCACGACAGCTTCCGCGCGGATCGACTGGACTTGTTGCCCAAGGTGTGTCGAAAGACCGGTGTCAAGGCAAAATGCATGCAGCACGACGCAACAAAACCTTCCGTAGGGGACAATTCGCGCACGGAGACGAATCCCGTGTCCCGTTTGAAACTGTGTCAGTTGGCTTTAACTAAAACTCTGAAAGAGATTGTTGAAGAATATCAACAAAATTATAAGAAACCATCAATTGTATTACCAAAGGACAATCCAAAAGAAATAAACTCTCAAGATACAGGTCCTATTCTGTATAAAGTGCATTTAGATGGTGTTCATAACAAAAAGTCTGCCGTAGAACAGAATACAAAGTATTCAGCCTTTCTTCCTCCAAAGAATGTATCCAAACAGGAAGAAGCATTTTTCTTACCTTTGTGTGTTGCAACAGTGAATAAATACGGCATGCATCTCAAGATTCCAAATATAAAATCAGCTTAG
- Protein Sequence
- MFDDCVLQSMRFPQKLWRIVNECKTGAIRWGANGDTILLDYKKFQTEYLDAHRPIFKTNNITSFIRQLNLYGFRKVTSHNRDPMCNFCNPHVHEFMHDSFRADRLDLLPKVCRKTGVKAKCMQHDATKPSVGDNSRTETNPVSRLKLCQLALTKTLKEIVEEYQQNYKKPSIVLPKDNPKEINSQDTGPILYKVHLDGVHNKKSAVEQNTKYSAFLPPKNVSKQEEAFFLPLCVATVNKYGMHLKIPNIKSA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01266798;
- 90% Identity
- iTF_01267461;
- 80% Identity
- -