Basic Information

Transcription Factor Domain

TF Family: TF_bZIP
Domain: bZIP domain
PFAM: AnimalTFDB
TF Group: Basic Domians group
Description: bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.3 1.3e+03 -0.2 0.1 47 53 30 36 22 49 0.56

2 3 0.00022 0.22 12.0 5.3 26 60 49 83 32 86 0.91

3 3 2.4e-06 0.0024 18.2 3.9 26 63 84 121 77 123 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.3	1.3e+03	-0.2	0.1	47	53	30	36	22	49	0.56
2	3	0.00022	0.22	12.0	5.3	26	60	49	83	32	86	0.91
3	3	2.4e-06	0.0024	18.2	3.9	26	63	84	121	77	123	0.89

Coding Sequence: ATGTGTTCCCTGCAGTTTAGCTCTGAACCAATCGCAACTACTCCCGGAGGATGGCTCGTCGGTGATGAGGCACTTCAACAAATCAACGAAGTACAACGTCTCAGAAACAAGGATCTCGAAAACACAATAAAGGATTTCGAAAATAGAATCAAGGATCTCCAAAATAGAATCAAGGATCTCGAAAATAAAAACAAAGATCTCAATAATAAAATCAAAGATCTCGAAAATAGAAACAAGGATCTCGAAAATAGAATCGAAAATCTTGAAAATAGAATCAAGGATCTCGAAAATAGAAACAAGGGTCTCGAAAATAGAAACAAGGATCTCGAAAATAGAATCAAGGATCTCGAAAATACGATCATAGAGTTGAATCAGAAAACATTCTACTAA
Protein Sequence: MCSLQFSSEPIATTPGGWLVGDEALQQINEVQRLRNKDLENTIKDFENRIKDLQNRIKDLENKNKDLNNKIKDLENRNKDLENRIENLENRIKDLENRNKGLENRNKDLENRIKDLENTIIELNQKTFY

Sequence clustering based on sequence similarity using MMseqs2