Basic Information

Insect: Pseudoips prasinana
Gene Symbol: -
Assembly: GCA_951640165.1
Location: OX621260.1:1179599-1180821[+]

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 1.9 9.8e+02 1.9 0.2 17 23 11 17 5 19 0.86

2 14 0.32 1.7e+02 4.3 0.1 15 23 24 32 22 34 0.88

3 14 0.32 1.7e+02 4.3 0.1 15 23 39 47 37 49 0.88

4 14 0.32 1.7e+02 4.3 0.1 15 23 54 62 52 64 0.88

5 14 0.32 1.7e+02 4.3 0.1 15 23 69 77 67 79 0.88

6 14 0.32 1.7e+02 4.3 0.1 15 23 84 92 82 94 0.88

7 14 0.32 1.7e+02 4.3 0.1 15 23 99 107 97 109 0.88

8 14 0.32 1.7e+02 4.3 0.1 15 23 114 122 112 124 0.88

9 14 0.32 1.7e+02 4.3 0.1 15 23 129 137 127 139 0.88

10 14 0.32 1.7e+02 4.3 0.1 15 23 144 152 142 154 0.88

11 14 0.32 1.7e+02 4.3 0.1 15 23 159 167 157 169 0.88

12 14 0.32 1.7e+02 4.3 0.1 15 23 174 182 172 184 0.88

13 14 0.32 1.7e+02 4.3 0.1 15 23 189 197 187 199 0.88

14 14 0.32 1.7e+02 4.3 0.1 15 23 204 212 202 214 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	1.9	9.8e+02	1.9	0.2	17	23	11	17	5	19	0.86
2	14	0.32	1.7e+02	4.3	0.1	15	23	24	32	22	34	0.88
3	14	0.32	1.7e+02	4.3	0.1	15	23	39	47	37	49	0.88
4	14	0.32	1.7e+02	4.3	0.1	15	23	54	62	52	64	0.88
5	14	0.32	1.7e+02	4.3	0.1	15	23	69	77	67	79	0.88
6	14	0.32	1.7e+02	4.3	0.1	15	23	84	92	82	94	0.88
7	14	0.32	1.7e+02	4.3	0.1	15	23	99	107	97	109	0.88
8	14	0.32	1.7e+02	4.3	0.1	15	23	114	122	112	124	0.88
9	14	0.32	1.7e+02	4.3	0.1	15	23	129	137	127	139	0.88
10	14	0.32	1.7e+02	4.3	0.1	15	23	144	152	142	154	0.88
11	14	0.32	1.7e+02	4.3	0.1	15	23	159	167	157	169	0.88
12	14	0.32	1.7e+02	4.3	0.1	15	23	174	182	172	184	0.88
13	14	0.32	1.7e+02	4.3	0.1	15	23	189	197	187	199	0.88
14	14	0.32	1.7e+02	4.3	0.1	15	23	204	212	202	214	0.88

Sequence Information

Coding Sequence: ATGAAGAACACAATTAAGTTCAAACACGGGGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGGGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGGGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGGGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGGGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGCGGCACGGGCGTGTTGGCGCAGGTAGCACGGTGCGCCTACTGCGGGGGCACGGGCGTGTTGGCGCAGGTAGCACGGTAG
Protein Sequence: MKNTIKFKHGARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVARCAYCGGTGVLAQVAR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -