Plon005434.1
Basic Information
- Insect
- Pseudococcus longispinus
- Gene Symbol
- -
- Assembly
- GCA_900064475.1
- Location
- FIZU01048105.1:438-1333[+]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1e-09 5.9e-07 29.5 0.0 4 35 18 49 15 57 0.90 2 2 5.5 3.3e+03 -1.7 0.0 2 15 90 103 89 105 0.79
Sequence Information
- Coding Sequence
- atgGTCCGAAACTATAAGCGTAAGACCAAGAAAGGAAATTATGATCCAATAAACTTCCAGCAAGCTCTAGAGAAGGTGCAGACAAAGCAAATGAACATTAGCGAAGCATCTAACTTCTATGGTATCGCTTATGCAACATTACACGATTCTTTAACCGGAAAATCCAAGTCTCACCAAATGGGGAGATGTACTGTGATAATTTGGGAGGAAGAAGTGAAATTGGCCAACGGCTTAAGAGTTATGGAAAAATGGGGATATGGATTAAGCCGTACTGAAGTACGGGAAGCAATCGGCGAATATGTAAACGGTAATAAGTTGGATACTCCATTCAAAAACGGTATACCAGGAGAAGAttggtttttacattttaagaAACGCCACAACCTAGT
- Protein Sequence
- MVRNYKRKTKKGNYDPINFQQALEKVQTKQMNISEASNFYGIAYATLHDSLTGKSKSHQMGRCTVIIWEEEVKLANGLRVMEKWGYGLSRTEVREAIGEYVNGNKLDTPFKNGIPGEDWFLHFKKRHNL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -