Plon017522.1
Basic Information
- Insect
- Pseudococcus longispinus
- Gene Symbol
- Tfcp2_1
- Assembly
- GCA_900064475.1
- Location
- FIZU01006706.1:1-1326[-]
Transcription Factor Domain
- TF Family
- CP2
- Domain
- CP2 domain
- PFAM
- PF04516
- TF Group
- Beta-Scaffold Factors
- Description
- This family represents a conserved region in the CP2 transcription factor family.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.5e-17 8.8e-14 51.7 0.0 14 76 43 103 19 106 0.80
Sequence Information
- Coding Sequence
- ATGAACagtttattaataatttgtttattttttctcgcaGATGTAAAACAACACAATGATTGCCAGGTATACAACAAAGAAAATAATAGTAATTATTGTAGAGAACATATTACTACTCCGAATACCGTTACAACATGTCCATCTTCTCCAGATGCTTTGGATGATTCATTTAGatttcagtaTGTTCTTTGCGCCGCTACATCCattgcaatgaaaataaacgaGGAAACGTTGACGTATTTGAATCAAGGGCAACCTTATGAAAtcaagttgaagaaattaGGAGATTTAACTCAATTGAGAGGCAAAGTTTTTAAG
- Protein Sequence
- MNSLLIICLFFLADVKQHNDCQVYNKENNSNYCREHITTPNTVTTCPSSPDALDDSFRFQYVLCAATSIAMKINEETLTYLNQGQPYEIKLKKLGDLTQLRGKVFK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -