Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00015 0.0084 15.6 0.8 1 23 53 75 53 75 0.97

2 6 1.4e-05 0.00077 18.9 0.8 1 23 81 104 81 104 0.94

3 6 4.7e-07 2.7e-05 23.5 0.4 1 23 110 133 110 133 0.98

4 6 0.00016 0.009 15.5 0.9 1 23 138 160 138 160 0.99

5 6 6.7e-06 0.00038 19.8 1.9 1 19 166 184 166 189 0.94

6 6 3.9e-06 0.00022 20.6 0.2 1 22 195 216 195 219 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00015	0.0084	15.6	0.8	1	23	53	75	53	75	0.97
2	6	1.4e-05	0.00077	18.9	0.8	1	23	81	104	81	104	0.94
3	6	4.7e-07	2.7e-05	23.5	0.4	1	23	110	133	110	133	0.98
4	6	0.00016	0.009	15.5	0.9	1	23	138	160	138	160	0.99
5	6	6.7e-06	0.00038	19.8	1.9	1	19	166	184	166	189	0.94
6	6	3.9e-06	0.00022	20.6	0.2	1	22	195	216	195	219	0.92

Coding Sequence: ATGGCACAAAAGAATATGTATGCCAACAGTGCGtctaaaggcttagAACGCTTGCAGGGAATGCAAAAGATCCGGGTgcgactcccggccgagataaacaCGTTATCATCTCAAAAACTTTGCAACAacataaacatacatattgaCGTTAGGCCCCACAAATGCGGAGAGTGTGGTAAAGCGTTTCTGTATGGATCGTATTTGCGTCGTCATGAGATGATTCATGCAGAGGAAAAACCTTATCAATGCGAATTTTGCGAAATATCATTTAATTATAAATCGGTTCTAAAAAGACACATAGAGGCCAAGCAttgcattgataaaaattacaagtgCGTCATGTGTGAGAAAGCTTTCAAAACTCAGCCAGAATTGCGTTATCATATAAACACGATTCATTTCCAAAAACAGTATAAATGTAATCAATGTCCATCTACATTTGCCCATCCTAAGATCTTAAGAGAGCACATAAAAATACATGCAGGCAAGAAATCATATATTTGCGAGATTTGCGGCAAaggttttacttttaaaagtaacCTAAACGATCACTGCACATATGTACATAGCGATGAAAAGCCGTATGAATGTTTGATGTGTGGCAAGAGCTACAAGCGAAAAAGGGCACTTGATGAACACATTCGAGCTGAGggTCACAAAAATAACATCACCTATATGACAAGTAAAGAACAAACTGCAGCTGACAACAAAACAGATAAAGAACAATTA
Protein Sequence: MAQKNMYANSASKGLERLQGMQKIRVRLPAEINTLSSQKLCNNINIHIDVRPHKCGECGKAFLYGSYLRRHEMIHAEEKPYQCEFCEISFNYKSVLKRHIEAKHCIDKNYKCVMCEKAFKTQPELRYHINTIHFQKQYKCNQCPSTFAHPKILREHIKIHAGKKSYICEICGKGFTFKSNLNDHCTYVHSDEKPYECLMCGKSYKRKRALDEHIRAEGHKNNITYMTSKEQTAADNKTDKEQL

Sequence clustering based on sequence similarity using MMseqs2