Pinq028805.1
Basic Information
- Insect
- Prosopocoilus inquinatus
- Gene Symbol
- CEBPG
- Assembly
- GCA_036172665.1
- Location
- CM069879.1:1573445-1573844[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 7.6 1.2e+04 -2.7 0.1 15 26 2 13 1 16 0.65 2 2 1.6e-14 2.6e-11 44.3 5.4 3 65 19 81 17 81 0.95
Sequence Information
- Coding Sequence
- ATGGCCCCGAAGAGAGGCAAAGTGAAGAAAGACCAGGAATCCGAGGAGGACACCGATGAATACCGCAAGAAAAGAGACCGCAACAATCTGGCTGTGAAGAGGAGTCGACAGAAGTCGAAAGTGAAAACCATCGAGACCATGAACAGGGTGAACGAGCTGAGGAACGAGAACACAGTGCTTCAGGAGAAGGTGAAGACGCTGACGAAGGAGCTCGGGTTTTTGAAGGAGCTGTTTCTGGCGCACGCCGGAAACACAGGGGACACGGGGAGGTTTACAGAGGTTGATTTACAGACTTTACTAGCCGAAGATAGCAGTGCGGAGGATATGAAGTGA
- Protein Sequence
- MAPKRGKVKKDQESEEDTDEYRKKRDRNNLAVKRSRQKSKVKTIETMNRVNELRNENTVLQEKVKTLTKELGFLKELFLAHAGNTGDTGRFTEVDLQTLLAEDSSAEDMK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00980679;
- 90% Identity
- iTF_00465730;
- 80% Identity
- -