Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 5e-07 0.00034 20.5 1.3 12 44 41 70 36 70 0.90

2 9 0.0088 5.9 7.0 0.4 16 44 77 102 71 102 0.77

3 9 0.018 12 6.0 2.3 1 26 122 145 122 149 0.87

4 9 0.00019 0.13 12.3 2.4 5 29 153 175 151 181 0.89

5 9 0.00022 0.15 12.1 5.0 5 40 180 209 177 213 0.87

6 9 0.052 35 4.5 9.9 1 41 202 238 202 250 0.80

7 9 5.1 3.4e+03 -1.9 2.2 17 41 247 268 239 269 0.72

8 9 6 4.1e+03 -2.1 3.1 4 27 263 287 260 300 0.66

9 9 0.037 25 5.0 1.5 9 43 298 329 291 330 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	5e-07	0.00034	20.5	1.3	12	44	41	70	36	70	0.90
2	9	0.0088	5.9	7.0	0.4	16	44	77	102	71	102	0.77
3	9	0.018	12	6.0	2.3	1	26	122	145	122	149	0.87
4	9	0.00019	0.13	12.3	2.4	5	29	153	175	151	181	0.89
5	9	0.00022	0.15	12.1	5.0	5	40	180	209	177	213	0.87
6	9	0.052	35	4.5	9.9	1	41	202	238	202	250	0.80
7	9	5.1	3.4e+03	-1.9	2.2	17	41	247	268	239	269	0.72
8	9	6	4.1e+03	-2.1	3.1	4	27	263	287	260	300	0.66
9	9	0.037	25	5.0	1.5	9	43	298	329	291	330	0.81

Coding Sequence: atgttatcATCAACAAGTTCTGATCAAGTGTTATCAACTGAAGTAAAATCTAACTTAAACCGTgcatttcttttgatttcaaacaatgaaaatcaacaacaaaataaaagtcaaaaaccTACAgccgaaaatgaaaatatttgcagAATTTGTGAGAAGAAActaatttcaaaaagtaatttaattcagcatatcaaaaatgttcattcaaatgaaatttcattaaaagttcttttttgtgatcattgtgatttgaaatttattcagaaaGGTTCATtgatttctcatttaaaatcaaaacatcaaaaaggaaaagaaatcaaatttgaatgcgattttgatggaaaattttttgatactaAATCGAAACTTTATTATCATATGAAACAATGTCATCGAACCATTGAAGAATgcaaaatttgtgaaaaaaatgtaagaagTTTCAATTACCATATGAAATATTATCATACTGcagaagataaaaaagttcattgtcaaatttgcaataaaactttcaaaggTCAATATTTGTTGAATCAACATTTTAAAacacataacaaaaaatatcaatgtcAAATGTgtggcaataaattttcaaattcttcaaaattaaaaaatcatttaaaagtaCATAAAAATCTACAAACTTTTCGTTGCAATGAATGTCAAAAATGTTATAGTTCCgcagaaaatttaagaaatcatttgaaaactcatgagaaaaatagaataaaaaaccATAAATGTCAACAATGTGAATATTCAACtgatagaaaatataaattgaaaaatcatctTAAAACTCATGATAGGAAccgaattaaaaattttaaatgtaatcaATGTGATTATAAAACTGACCGAATGGGTGATCTTAAGCTTCATCTTCAAATTCATAATCCAAATCGAGCAAAATTTCCATGTTTGTATTGCAAATATGAAGCAACTCAAAGAAGTAGTCtaaaaacacattttaaaTCTCAGCATGATCCAAAAAGAGTCTAA
Protein Sequence: MLSSTSSDQVLSTEVKSNLNRAFLLISNNENQQQNKSQKPTAENENICRICEKKLISKSNLIQHIKNVHSNEISLKVLFCDHCDLKFIQKGSLISHLKSKHQKGKEIKFECDFDGKFFDTKSKLYYHMKQCHRTIEECKICEKNVRSFNYHMKYYHTAEDKKVHCQICNKTFKGQYLLNQHFKTHNKKYQCQMCGNKFSNSSKLKNHLKVHKNLQTFRCNECQKCYSSAENLRNHLKTHEKNRIKNHKCQQCEYSTDRKYKLKNHLKTHDRNRIKNFKCNQCDYKTDRMGDLKLHLQIHNPNRAKFPCLYCKYEATQRSSLKTHFKSQHDPKRV

Sequence clustering based on sequence similarity using MMseqs2