Basic Information

Insect: Polydrusus tereticollis
Gene Symbol: -
Assembly: GCA_963920685.1
Location: OY987330.1:13017902-13020794[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 1.4e-06 0.00045 23.5 1.8 1 23 21 43 21 43 0.96

2 8 2.6e-05 0.0086 19.5 0.6 1 23 52 75 52 75 0.97

3 8 0.00085 0.28 14.7 3.4 1 23 81 104 81 104 0.97

4 8 0.00014 0.046 17.1 1.0 3 23 114 136 112 136 0.92

5 8 0.00012 0.039 17.4 2.1 1 23 141 164 141 164 0.96

6 8 2e-05 0.0064 19.9 2.1 1 23 172 194 172 194 0.99

7 8 1.4e-05 0.0045 20.3 0.5 1 23 200 222 200 222 0.96

8 8 1.3e-05 0.0043 20.4 0.1 1 23 228 251 228 251 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	1.4e-06	0.00045	23.5	1.8	1	23	21	43	21	43	0.96
2	8	2.6e-05	0.0086	19.5	0.6	1	23	52	75	52	75	0.97
3	8	0.00085	0.28	14.7	3.4	1	23	81	104	81	104	0.97
4	8	0.00014	0.046	17.1	1.0	3	23	114	136	112	136	0.92
5	8	0.00012	0.039	17.4	2.1	1	23	141	164	141	164	0.96
6	8	2e-05	0.0064	19.9	2.1	1	23	172	194	172	194	0.99
7	8	1.4e-05	0.0045	20.3	0.5	1	23	200	222	200	222	0.96
8	8	1.3e-05	0.0043	20.4	0.1	1	23	228	251	228	251	0.97

Sequence Information

Coding Sequence: ATGGAGGACGCAACAAGAAGATATCCTGAGGACGTTGTGGTTGTGATGGACCAGGGAACGTATCTTTGTAACGAATGCGGCAAAAAATTTATCAAGAAGAGCTCATTGTACGTGCATACGAGACGACACGAAAAACGTAAACAGGgaatTTGTTTTCCATGCAAAGTCTGTGGCATCACTTTCCGCGACAAGAAAACTATGGATATCCACACGCGAAAAGTTCACATTAAGGATTTTCAGTATTGTTGTGATCAGTGTGGTAAAGCTTTTGTTTGTAAAGGTCACTTAAACGGTCATATTAAAATTGCTCATCAGAAGCAGGATTCAACGATATTTTTGTGTGATTACGATGGATGTAATGAATCCTTCAGAAGGAAAGCCACTCTTCAataTCATCgtttaaaacacaaaaataaaatttaccccTGCAATTTCTGTGAAAAAGTCTTTGTGCACCCCTATAGACTTAAGATGCACGTTAAGAATTATCACGGAAACCGACCAAAAAAATTGTTTCAATGTAAATTCTGTGATCTACAACTTACAACGAAAACAAGCTTGAGGGACCATATTCGAACACATACCGGCGAAAAGCCGTTCATTTGTGAGCAGTGTGGCAAGAATTTTACCACGATTCAACAGCTTAAGAATCACACTGTCGTTCATACGAAGGCGAGACCTTTTGCTTGTACTCTTTGTGATAAAACGTTTACACAGAGAGGGGCTATGGGTGTTCATATTAAGACTGCTCATACTCTAATTAAGATTGACGTATAG
Protein Sequence: MEDATRRYPEDVVVVMDQGTYLCNECGKKFIKKSSLYVHTRRHEKRKQGICFPCKVCGITFRDKKTMDIHTRKVHIKDFQYCCDQCGKAFVCKGHLNGHIKIAHQKQDSTIFLCDYDGCNESFRRKATLQYHRLKHKNKIYPCNFCEKVFVHPYRLKMHVKNYHGNRPKKLFQCKFCDLQLTTKTSLRDHIRTHTGEKPFICEQCGKNFTTIQQLKNHTVVHTKARPFACTLCDKTFTQRGAMGVHIKTAHTLIKIDV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01244487;
90% Identity: -
80% Identity: -