Ppte015089.1
Basic Information
- Insect
- Polydrusus pterygomalis
- Gene Symbol
- -
- Assembly
- GCA_963969555.1
- Location
- OZ018376.1:30553095-30553469[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.9e-07 0.00011 23.9 0.0 1 37 15 52 15 59 0.88
Sequence Information
- Coding Sequence
- atggttGGTACATACGCCCGAAAGTCACAGCGACAAAGTTGGAGTGAAGAAAATATGTTACAAGCACTTaacgcaattaaaaataaagaaatgggATGGTTTTTGGCATCGAAATCATTTAAAGTGCCGCAGACAACGTTAAGAAGACGTGCTAAAGATGATCGTGGATCCAAAAAGGGTTATTTAGGAGGACATGTTCCAACTTTTAATGCCGAGTTGGAAGATGAATTGGTGCAtcatataaaagaattagaagtGCGTTTTTTTGGACTAACAACGTTAGATCTTCGAAGGCTTGCCTATGAAATTGCCGatgtaaaaaatattccaaatagGTTTTCACAGGAAAAAAAATGGCAGGCTGGGATTGGCTGA
- Protein Sequence
- MVGTYARKSQRQSWSEENMLQALNAIKNKEMGWFLASKSFKVPQTTLRRRAKDDRGSKKGYLGGHVPTFNAELEDELVHHIKELEVRFFGLTTLDLRRLAYEIADVKNIPNRFSQEKKWQAGIG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -