Pcer018313.1
Basic Information
- Insect
- Polydrusus cervinus
- Gene Symbol
- -
- Assembly
- GCA_935413225.1
- Location
- CAKXYS010000392.1:305630-305974[+]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.2 1e+02 4.0 0.1 12 23 11 22 10 24 0.87 2 2 6.4e-08 5.5e-06 27.3 0.1 4 39 20 56 19 62 0.79
Sequence Information
- Coding Sequence
- ATGCCATCCGAATACAAAAGAAAAGGGAAAGTTGTAAGGGGTAAAATGACCATACAACAATTATCAGCAGCAATTAGTGCTATTGAGAGCCTAGAGAAGGGGATCCGTCAAGCTGGTCGTGAATATAATATTCCTGAAGGAACCTTACGACGTCGAATGAAAAGCACAGATCTTCAAAACAAGAGGCTAGGGCCGCATTCTTTGTTGGGGACTGAAAACGAAGTCAAAATAGTGAACCACATTAAAAAGATATGGCTTTTGAACTGGcagaaaaatcaaaattgtcACACAAATTTATTGAAGAGTCTAGAAAAGCTAGCTATCCTTGGTTTGCATCttttttaa
- Protein Sequence
- MPSEYKRKGKVVRGKMTIQQLSAAISAIESLEKGIRQAGREYNIPEGTLRRRMKSTDLQNKRLGPHSLLGTENEVKIVNHIKKIWLLNWQKNQNCHTNLLKSLEKLAILGLHLF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -